Loading...
The URL can be used to link to this page
Your browser does not support the video tag.
Home
My WebLink
About
Permit File BLD-2023-1122 1120 4th Street
12'-7 1/2"37'-0" gravel alley 3'-0" 1' - 0 " s 89n59'10" w 59.91' sid e w a l k EXIST. HOUSE PROPOSED GARAGE FA C E O F C U R B 'N ' A V E N U E N 0 0 n00 ' 0 7 " w 9 9 . 8 5 ' ' 10 ' S I D E S E T B A C K 10 ' S I D E S E T B A C K N 0 0 n00 ' 0 7 " w 9 9 . 8 5 ' ' EXIST. COV'D PORCH s 89n59'40" w 59.91' SIDEWALK 4TH STREET proposed eLEVATOR ADDITION DECK ADDITION AREA OF exist. DECK TO BE REMOVED DRIVEWAY ADDITION EXISTING DRIVEWAY ADD STEPS ADD STEPS 14 ' - 0 " 10'-3 1/2" 11 ' - 8 " EDGE OF BREEZEWAY ADDITION 25 ' - 8 " 25 ' - 8 " 9' - 5 3 / 4 " 41 ' - 9 " 8' - 2 " 13 ' - 9 1 / 2 " proposed breezeway 5' - 6 1 / 2 " 10'-0" 26'-0" 24'-4" 8' - 2 " Exist. fence slight slope 1-2% slight slope 1-2% BMP C105: construction entrance 1 2 3 4 (e) conc. path 5 bmp C233: silt fence outline of (e) garage to be demo'd concrete gravel 20 ' - 0 " EXIST. DECK EXIST. lawn conc. path line of building footprint EXIST. lawn line of roof eave (e) s.s. (e ) s . s . (a s s u m e d ) (e) s.s. stub (e) water (e) water meter (e ) s . d . nearest fire hydrant ~130' to north (e) elec. meter (e ) p o w e r bmp C103: high visibility fence to help designate construction zone and protect vegetation. BMP C107 BMP C106 BMP C154 BMP C254 AREA OF ADDITION/new building existing LAWN PAVED (CONCRETE) SURFACE GRAVEL AREA surface existing deck new deck property line building setback line of bUILDING footprint line of roof utility line silt fence high visibility fence 5*''61( A1 ,+/&70.#2 Ä ,+/",&&'5+)0&4#(6+0)%1/ SITE & LANDSCAPE PLAN 5%#.'Ä0146* MCCOLLISTER GARAGE & ADDITION 1120 4TH STREET ANACORTES, WASHINGTON PARCEL ID# P55347 RTQLGEVFGUETKRVKQPPGYICTCIGDTGG\GYC[ GNGXCVQT CFFKVKQPUHQTUKPINGÄHCOKN[TGUKFGPEGGZKUVKPIICTCIGYKNN DGFGOQFEQORNGVGN[CPFTGRNCEGFD[PGYNCTIGTICTCIG \QPKPIFGUKIPCVKQPNKIJVOCPWHCEVWTKPI CO V E R P A G E & S I T E & L A N D S C A P E P L A N 4'8+5+105 24 1 , ' % 6 0' 9 ) # 4 # ) ' $ 4 ' ' < ' 9 # ; ' . ' 8 # 6 1 4 # & & + 6 + 1 0 5 ( 1 4 5 + 0 ) . ' Ä ( # / + . ; 4 ' 5 + & ' 0 % ' MC C O L L I S T E R G A R A G E & A D D I T I O N 5+ 6 ' # & & 4 ' 5 5 6 * 5 6 4 ' ' 6 #0 # % 1 4 6 ' 5 9 # 5 * + 0 ) 6 1 0 2# 4 % ' . 2 &4#90$; 5%#.' ,&,1$ ' ,#& #5016'& 4'Ä/%%1 2# ) ' & ' 5 % 4 + 2 6 + 1 0 SITE ADDRESS: 1120 4th street ANACORTES, WA 98221 PARCEL: P55347 ASSESSOR'S TAX ACCT.#: 3772-065-012-0009 qtr: sE, sec: 13, twn: 35, rng: 01 parcel size: 6098.4 S.F. PROPERTY OWNERS: john tatum & susan kim mccollister 1120 4th street anacortes, wa 98221 PROPERTY INFO. PROJECT INFO. CONDITIONED living space 2174 S.F. covered front porch 198 S.F. open deck 316 s.f. EXISTING main floor living space 43 S.F. upper floor living space 43 s.f. total new living space 86 s.f. (note: elevator only counted once: half on each floor) garage 868 s.f. breezeway 77 S.F. OPEN DECK 65 s.f. NEW SQUARE FOOTAGE IS MEASURED TO THE OUTSIDE FACE OF WALLS OF ALL FINISHED SPACE. STAIRWELLS ARE COUNTED ONCE, APPROX. HALF ON TOP FLOOR, HALF ON BOTTOM. OPEN TO BELOW SPACES ARE NOT INCLUDED IN CALCULATIONS. GARAGE AREA IS CALCULATED SEPARATELY. A1 SITE & LANDSCAPE PLAN & COVER PAGE A2 FOUNDATION & main floor framing PLAN & details A3 FLOOR PLANs A4 upper floor framing & lower roof framing plan & upper roof framing plan A5 building sections & details A6 elevations north & west A7 Elevations south & east a8 EXISTING FLOOR PLAN & ELEVATIONS s1 structural foundation plan s2 structural drawings & details s3 standard structural specifications DRAWING INDEX BMP'S 1 2 BMP C105: construction entrance. CONSTRUCTION ACCESS ALREADY EXISTS AT EXISTING DRIVEWAY LOCATION. BMP C107: CONSTRUCTION ROAD/PARKING AREA. USE EXISTING DRIVEWAY/PARKING AREA. BMP C123: TEMPORARY SOIL STOCKPILE LOCATION. COVER STOCKPILE W/ STRAW OR VISQUEEN & INSTALL SILT FENCE AROUND DOWN SLOPE SIDE(S). BMP C154: DESIGNATED CONCRETE WASH-OUT AREA BMP C233: SILT FENCE. INSTALL SILT FENCE ON DOWNSLOPE SIDES OF CONSTRUCTION SITE. note: silt fence will also designate construction limits & protect natural VEGETATION area. 3 4 5 SITE & LANDSCAPE LEGEND LOT COVERAGE BUILDING FOOTPRINT 1100 S.F. COVERED FRONT PORCH 198 S.F. open deck 316 s.f. TOTAL EXISTING LOT COVERAGE 1614 S.F. EXISTING ADDITION FOOTPRINT 55 S.F. garage footprint 868 s.f. breezeway 77 s.f. open DECK 65 S.F. TOTAL NEW LOT COVERAGE 1065 S.F. EXISTING 1614 S.F. + NEW 1065 S.F. 2679 S.F. percentage of 6098.4 s.f. lot 43.9% NEW TOTAL IMPERVIOUS SURFACE UNDER ROOF INCL. COV'D porch 1449 S.F. PAVED (conc.) DRIVEWAY 224 S.F. paved (conc.) walkway 44 s.f. gravel areas 214 s.f. TOTAL EXISTING impervious surface 1931 S.F. EXISTING NEW EXISTING 1931 S.F. + NEW 1390 S.F. 3321 S.F. percentage of 6098.4 s.f. lot 54.5% addition UNDER ROOF INCL. breezeway 120 S.F. garage under roof 982 s.f. paved (conc.) driveway 172 s.f. paved (conc.) walkway 29 s.f. gravel areas 87 s.f. total new impervious surface 1390 s.f. TOTAL FIRE AREA EXISTING FIRE AREA, incl. cov'd porch 1298 S.F. NEW FIRE AREA incl. addition, breezeway & garage 1002 S.F. TOTAL FIRE AREA 2300 S.F. x DOWNSPOUT AND FOOTING DRAINS WILL BE TIGHTLINED IN 4" PVC AND CONNECTED TO THE EXISTING STORM DRAIN TIGHTLINE. DRAINAGE NOTES x CONTRACTOR TO INSTALL SILT FENCING ON DOWN SLOPE SIDE OF CONSTRUCTION SITE. SILT FENCING TO REMAIN UNTIL ALL CONSTRUCTION IS COMPLETED AND LANDSCAPE IS IN PLACE. x IN ADDITION TO SILT FENCING COVER ALL stockpiled soil with visqueen. EROSION CONTROL NOTES x ADDITION WILL BE HEATED BY EXISTING mini-split heat pump system. GENERAL NOTES CONSTRUCTION WILL COMPLY WITH: BUILDING & STRUCTURAL 2018 IRC MECHANICAL 2018 IRC PLUMBING 2018 UPC ENERGY & VENTILATION 2018 WSEC BUILDING CODES this addition is less than 500 s.f. and therefore WILL REQUIRE 1.5 CREDITS ENERGY CREDITS OPTION DESCRIPTION CREDITS 3.3 ductless mini-split heat pump, installed in 2018 1.5 heat hp fuel equalization heat pump credit 1.0 TOTAL ENERGY CREDITS 2.5 x most of the existing landscaped/lawn areas will remain in place. at least 35% of the lot will be landscaped. any existing landscape/lawn areas disturbed during construction will be restored fully. LANDSCAPE NOTES CITY OF ANACORTES PLANNING AND BUILDING DEPT: APPROVED PLANS REVIEWED FOR CODE COMPLIANCE PERMIT #:______________________________ ADDRESS:______________________________ APPROVED BY:__________________________ SUBJECT TO FIELD INSPECTION. APPROVED PLANS SHALL NOT BE ALTERED WITHOUT AUTHORIZATION. BLD-2023-1122 1120 4TH ST Approved 08/25/2023 Sidewalk to meet city engineering standards. Driveway entrance permitted to face N due to site constraints. 13 ' - 9 3 / 4 " 16 ' - 2 1 / 4 " (E) FLOOR JOI S T S ( D I R E C T I O N A S S U M E D ) (E ) F L O O R J O I S T S ( D I R E C T I O N A S S U M E D ) CONTRACTOR COORDINATE W/ ELEVATOR MANUF. FOR FRAMING REQUIREMENTS 4" concRETE slab w/ reinforcement per engineering, over 6 mil POLY vapor barrier, OVER 4" compacted GRANULAR fill 13'-9 1/4"11'-10 3/4" 37 ' - 0 " 14'-0"11'-8" 14'-0"11'-8" 25'-8"5'-6 1/2"3'-11 1/4" (E ) D E C K J O I S T S (E) DECK 2 x 6 p . t . d e c k J O I S T S LINE OF EXISTING DECK (e) post and beam foundation (assumed) (e) post and beam foundation (assumed) 2 x 6 joists over conc. slab at platform next to elevator new 2 x 6 p.t. deck joists added between new garage & existing deck supports new 2 x 6 p.t. deck joists added between new garage new elevator bump-out dbl joist @ edge (e) 4 x 6 typ. (e ) 4 x 6 t y p . p. t . 4 x 6 (+/-) 9'-3"1'-4 1/2"1'-0 1/2"1'-4 1/2"11'-3"1'-4 1/2" new 2 x 6 p.t. deck joists added between new deck supports & existing deck supports add dbl as needed dbl joist @ edge 4'-3" (+ / - ) (e) 4 x 6 6" stem wall typ. 5'-6 1/2"3'-11 1/4"(+/-) 10 ' - 0 " 6' - 1 " A A5 A A5 a5 5 a5 4 A2 2 a2 3 a2 1 a5 6 (interior supports not depicted) a2 3 3' - 0 " 4' - 0 " see engineering for strong wall detail see engineering for strong wall detail verify in field typ. (4) pl. see engineering s1 11 ' - 0 1 / 4 " 3'-4 1/4" a5 6 note: hold foundation stem wall down to top of elevator pit slab. coordinate w/ elevator manufacturer. (+ / - ) (+/-) elevator pit: concrete slab per elevator manuf. requirements conc. slab new foundation STEM WALL NEW FOUNDATION FOOTING EXISTING FND. STEM WALL EXISTING FOUNDATION FOOTING new floor joist existing floor joist new girder/beam existing girder/beam OUTLINE OF WALLS OF SUPPORTED FLOOR joist hanger new post EXISTING POST UNDISTURBED EARTH 2 x 6 joists @ 16" o.c. at platform next to elevator 3/4" t&g PLYWOOD OR OSB SUBFLOOR 1/2" GWB 2 x 6 studs @ 16" o.c. R-21 INSULATION 4" compacted granular fill see engineering for foundation size & reinforcing schedule see engineering for deck ledger specs DECK joists per plan decking GRADE 6" M I N . 1'- 6 " M I N . 4" DIA. DOWNSPOUT TIGHTLINE WATERPROOFING MEMBRANE CONTINUE OVER FOOTING DRAINAGE GRADE GRAVEL & FILTER FABRIC 4" DIA. PERFORATED DRAIN TILE 8" r-21 insulation r-10 rigid insulation 8" elevator pit: top of pit slab to sit 8" below floor of platform & exist. house 4" CONCRETE SLAB ON 6 MIL. VAPOR BARRIER @ elevator pit SLAB REINFORCEMENT OPTIONS PER ENGINEERING GRADE 6" M I N . 1'- 6 " M I N . 4" COMPACTED GRANULAR FILL 1/2" GWB option 2 x 6 studs @ 16" o.c. 4" DIA. DOWNSPOUT TIGHTLINE siding per elevations 7/16" CDX OR OSB SHEATHING 4" CONCRETE SLAB ON 6 MIL. VAPOR BARRIER SLAB REINFORCEMENT OPTIONS PER ENGINEERING anchor bolts per engineering WATERPROOFING MEMBRANE CONTINUE OVER FOOTING DRAINAGE GRADE GRAVEL & FILTER FABRIC 4" DIA. PERFORATED DRAIN TILE p.t. 2 x 6 sill plate UNDISTURBED EARTH see engineering for foundation size & reinforcing schedule 3/4" X 8" OFFSET VERIFY W/ DOOR SIZE SLOPE GARAGE CONC. PAD 2" TOWARD GARAGE DOOR 1' - 6 " M I N . (3) #4 REBAR CONT. as shown DRIVEWAY SLAB COMPACTED FILL GARAGE DOOR (2) #4 REBAR CONT. IN FOOTINGS hook #4 dowels @ 48" o.c. into centerline of slab UNDISTURBED EARTH see ENGINEERING for footing size and foundation reinforcement. 5*''61( A2 ,+/&70.#2 Ä ,+/",&&'5+)0&4#(6+0)%1/ FOUNDATION & MAIN FLOOR FRAMING PLAN 5%#.'Ä01 4 6 * 4'8+5+105 FO U N D A T I O N & M A I N F L O O R FR A M I N G P L A N & D E T A I L S 24 1 , ' % 6 0' 9 ) # 4 # ) ' $ 4 ' ' < ' 9 # ; ' . ' 8 # 6 1 4 # & & + 6 + 1 0 5 ( 1 4 5 + 0 ) . ' Ä ( # / + . ; 4 ' 5 + & ' 0 % ' MC C O L L I S T E R G A R A G E & A D D I T I O N 5+ 6 ' # & & 4 ' 5 5 6 * 5 6 4 ' ' 6 #0 # % 1 4 6 ' 5 9 # 5 * + 0 ) 6 1 0 2# 4 % ' . 2 &4#90$; 5%#.' ,&,1$ ' ,#& Ä701 4'Ä/%%1 2# ) ' & ' 5 % 4 + 2 6 + 1 0 TYP. FND. WALL DETAIL 5%#.'Ä1 FOUNDATION LEGEND GARAGE WALL DETAIL 5%#.'Ä2 x WRITTEN DIMENSIONS TAKE PRECEDENCE OVER SCALED DIMENSIONS. VERIFY ALL DIMENSIONS AND CONDITIONS IN THE FIELD. x ENGINEERING SPECIFICATIONS, NOTES AND DRAWINGS ACCOMPANIED WITH PLANS TO SUPERCEDE ALL INFORMATION ON ARCHITECTURAL DRAWINGS. FOR ANY DISCREPANCIES BETWEEN ENGINEERING AND ARCHITECTURAL DRAWINGS REFER TO ENGINEERING. x FOOTINGS ARE TO BEAR ON UNDISTURBED LEVEL SOIL DEVOID OF ANY ORGANIC MATERIAL AND STEPPED AS REQUIRED TO MAINTAIN 18" DEPTH BELOW GRADE. x COVER CRAWL SPACE GRADE WITH HIGH DENSITY POLYETHYLENE HIGH QUALITY VAPOR RETARDER. LAP EDGES 12" MIN. AND EXTEND 12" MIN. UP FOUNDATION WALL. x FILL UNDER SLABS ON GRADE TO BE MIN. 4" DEPTH GRANULAR MATERIAL COMPACTED TO 95%. x CONCRETE SLABS TO HAVE CONTROL JOINTS AT 25' MAX. INTERVALS EACH WAY. x CONCRETE SIDEWALKS TO HAVE 3/4" TOOLED JOINTS AT 5' O.C. EACH WAY. x WIRE MESH TO BE USED IN CONCRETE SLABS, POSITIONED IN MIDDLE THIRD OF SLAB. x USE HIGH DENSITY POLYETHYLENE HIGH QUALITY VAPOR RETARDER UNDER CONCRETE SLABS IN GARAGE AND BASEMENT. x A WATERPROOF MEMBRANE IS TO BE USED ON FOUNDATION WALLS BELOW GRADE. x DRAIN TILE WITH drain HOLES to be installed next to perimeter footings. x A LAYER OF ROUND, WASHED, DRAINAGE-GRADE GRAVEL IS TO BE USED OVER DRAIN TILE, NEXT TO FOOTINGS. 30-LB. FELT PAPER IS TO BE USED OVER THE GRAVEL. x ALL BOTTOM PLATES AND ANY LUMBER IN CONTACT WITH CONCRETE TO BE PRESSURE TREATED. x BEAM POCKETS IN CONCRETE TO HAVE 1/2" AIRSPACE AT SIDES & ENDS WITH MIN. BEARING OF 3". x FOLLOW ALL JOIST FRAMING DETAILS PER MANUFACTURER. x PROVIDE BLOCKING ABOVE ALL BEARING WALLS AND BEAMS. x ALL CONNECTORS AND FASTENERS IN CONTACT WITH PRESSURE TREATED WOOD SHALL BE HOT DIPPED GALVANIZED OR EQUIVALENT PROTECTION. x ACCESS SHALL BE PROVIDED TO ALL UNDER-FLOOR SPACES. ACCESS OPENING THROUGH PERIMETER WALL SHALL BE NOT LESS THAN 18" x 24". IF ANY PORTION OF THROUGH-WALL ACCESS IS BELOW GRADE AN AREAWAY NOT LESS THAN 18" x 24" SHALL BE PROVIDED (IRC R408.4). x CONTRACTOR TO COORDINATE FOUNDATION & SLAB BLOCK-OUTS W/ MECH. & ELECT. FOR SIZE & LOCATIONS. x ALL CONCENTRATED LOADS FROM ROOF TRUSSES MUST BE TRANSFERRED TO THE FOUNDATION WITH A BUILT-UP POST AND FOOTINGS AS REQUIRED. VERIFY LOCATIONS WITH TRUSS ENGINEER AND/OR STRUCTURAL ENGINEER. FOUNDATION NOTES GARAGE FOOTING 5%#.'Ä3 Approved 08/25/2023 HW 37 ' - 0 " 14'-0" 4' - 0 " 11'-8" 14'-0"11'-8" 13 ' - 4 1 / 4 " 13 ' - 4 1 / 4 " 11' W X 12' H O.H. DOOR 9' W X 8' H O.H. DOOR ELEVATOR ADDITION: CHECK ELEVATOR MANUF. REQ. FOR EXACT FRAMING REQUIREMENTS. 10 ' - 0 " 30 6 8 5'-6 1/2"3'-11 1/4"(+/-) DN 5R OLD LINE OF DECK AREA OF DECK ADDITION OLD LINE OF DECK AREA OF EXIST. DECK TO BE REMOVED 2 X 6 STUDS @ 16" O.C. TYP. 2 X 6 STUDS @ 16" O.C. TYP. add deck steps w/ handrail add deck steps edge of breezeway 14 ' - 0 " 30 6 8 2'-7 3/4" (+/-) 6 x 6 p o s t (existing area of deck) 9'-5 3/4"(+/-) 32'-0"9'-9"9'-5 3/4"(+/-)8'-2" 24 ' - 4 " 26 ' - 0 " 1'-6"11'-0"1'-6"1'-2"9'-0"1'-6" 3068 25'-8" elevator 5' - 1 0 " 4'-9" 5' - 1 " 2 X 4 @ inside 4' - 2 " 4'-0" 4'-3" (+/-) 2' - 1 " 6' - 1 " 7' - 1 1 " 5' - 1 0 " 3'-10" 2668 A A5 A A5 3' - 0 " EX. FAN 5'-2 1/2" 10 ' - 0 " ELEVATOR ADDITION: CHECK ELEVATOR MANUF. REQ. FOR EXACT FRAMING REQUIREMENTS. REPLACE EXISTING WINDOW W/ NARROWER WINDOW 7' - 1 1 " 6'- 1 " 26 ' - 0 " 32'-0"9'-9" 41'-9" 24 ' - 0 " 4' - 5 1 / 2 " 5'- 6 1 / 2 " 3' - 0 " CREATE OPENING FOR PASS-THROUGH 24 4 6 s h s. g . elevator 5'-6 1/2" 2' - 1 3 / 4 " 2'- 3 3 / 4 " 2 X 6 STUDS @ 16" O.C. TYP. 2 X 4 @ inside A A5 A A5 NEW AREA OF DECK deck EXIST. WALL new 2 x 6 wall NEW 2 x 4 WALL SAFETY GLASSS.G. 5*''61( A3 ,+/&70.#2 Ä ,+/",&&'5+)0&4#(6+0)%1/ PROPOSED MAIN FLOOR PLAN 5%#.'Ä01 4 6 * 4'8+5+105 PR O P O S E D F L O O R P L A N S 24 1 , ' % 6 0' 9 ) # 4 # ) ' $ 4 ' ' < ' 9 # ; ' . ' 8 # 6 1 4 # & & + 6 + 1 0 5 ( 1 4 5 + 0 ) . ' Ä ( # / + . ; 4 ' 5 + & ' 0 % ' MC C O L L I S T E R G A R A G E & A D D I T I O N 5+ 6 ' # & & 4 ' 5 5 6 * 5 6 4 ' ' 6 #0 # % 1 4 6 ' 5 9 # 5 * + 0 ) 6 1 0 2# 4 % ' . 2 &4#90$; 5%#.' ,&,1$ ' ,#& Ä701 4'Ä/%%1 2# ) ' & ' 5 % 4 + 2 6 + 1 0 PROPOSED UPPER FLOOR PLAN 5%#.'Ä01 4 6 * FLOOR PLAN LEGEND FLOOR PLAN NOTES x WRITTEN DIMENSIONS TAKE PRECEDENCE OVER SCALED DIMENSIONS. VERIFY ALL DIMENSIONS AND CONDITIONS IN THE FIELD. x CONFIRM ALL DOOR, WINDOW, CLOSET, AND ANY OTHER ROUGH OPENING SIZES WITH OWNER/ CONTRACTOR PRIOR TO WALL CONSTRUCTION. x ALL WOOD IN CONTACT WITH CONCRETE MUST BE PRESSURE TREATED MATERIAL. USE CORROSION RESISTANT FASTENERS WHEN IN CONTACT WITH PRESSURE TREATED LUMBER. x ALL EXTERIOR WALLS (EXCEPT GARAGE) TO BE FRAMED WITH 2 x 6 STUDS AT 16" O.C. AND SHEATHED WITH 7/16" OSB PLYWOOD OR BETTER WITH 15# BUILDING PAPER. x EXTERIOR GARAGE WALLS TO BE FRAMED WITH 2 x 6 OR 2 X 4 STUDS AT 16" O.C. AND SHEATHED WITH 7/16" OSB PLYWOOD OR BETTER WITH 15# BUILDING PAPER. x ALL INTERIOR WALLS TO BE FRAMED WITH 2 x 4 STUDS AT 16" O.C. AND SHEATHED WITH 1/2" GYPSUM WALLBOARD UNLESS NOTED OTHERWISE. x ALL GLASS TO HAVE LOW E GLAZING. GLAZING IN HAZARDOUS LOCATIONS TO BE TEMPERED PER IRC SECTION R308. SEE R308.4 FOR DEFINITION OF HAZARDOUS AREAS. x PROVIDE FIRESTOPS AT ALL APPLICABLE LOCATIONS, INCLUDING HOLES AND ANY OPEN AREAS. Approved 08/25/2023 elevator landing: 2 x 8 joists @ 16" o.c. or match existing joists ridge rid g e val l e y v a l l e y (E) FLOOR J O I S T S ( D I R E C T I O N A S S U M E D ) ELEVATOR 7:12 slope 3:12 slope 7:12 slope 4: 1 2 s l o p e PR E - M A N U F . S T A N D A R D T R U S S E S @ 2 4 " O . C . PR E - M A N U F . M O N O T R U S S E S @ 2 4 " O . C . 4: 1 2 s l o p e breezeway roof: pre-manuf. standard & mono trusses @ 24" o.c. (e ) f l o o r j o i s t s ( d i r e c t i o n a s s u m e d ) 1' - 0 " (+ / - ) meet eaves of lower garage section 8" 1' - 0 " 1' - 0 " 1'-0" (e ) r o o f r a f t e r s (E) roof ra f t e r s A A5 A A5 (interior bearing walls not depicted) a5 7 a5 8 a5 9 2 x 4 outlookers @ 4'-0" typ. flush w/ floor joists hip hip ridge (e) h i p (e) hip (e) ridge (e) 2 x 4 ro o f r a f t e r s new standard trusses @ 24" o.c. overframing 3: 1 2 s l o p e 3: 1 2 s l o p e 3:12 slope valley va l l e y A A5 A A5 a5 10 6'-6"~ beam in attic new line of floor or roof old line of floor or roof new GIRDER/BEAM existing girder/beam NEW floor joist or truss existing floor joist or truss OUTLINE OF WALLS BENEATH JOIST OR BEAM HANGER 5*''61( A4 ,+/&70.#2 Ä ,+/",&&'5+)0&4#(6+0)%1/ UPPER FLOOR FRAMING & LOWER ROOF FRAMING PLAN 5%#.'Ä01 4 6 * 4'8+5+105 UP P E R F L O O R F R A M I N G & L O W E R RO O F F R A M I N G P L A N & U P P E R RO O F F R A M I N G P L A N 24 1 , ' % 6 0' 9 ) # 4 # ) ' $ 4 ' ' < ' 9 # ; ' . ' 8 # 6 1 4 # & & + 6 + 1 0 5 ( 1 4 5 + 0 ) . ' Ä ( # / + . ; 4 ' 5 + & ' 0 % ' MC C O L L I S T E R G A R A G E & A D D I T I O N 5+ 6 ' # & & 4 ' 5 5 6 * 5 6 4 ' ' 6 #0 # % 1 4 6 ' 5 9 # 5 * + 0 ) 6 1 0 2# 4 % ' . 2 &4#90$; 5%#.' ,&,1$ ' ,#& Ä701 4'Ä/%%1 2# ) ' & ' 5 % 4 + 2 6 + 1 0 FLOOR & ROOF FRAMING LEGEND UPPER ROOF FRAMING PLAN 5%#.'Ä01 4 6 * ROOF NOTES x TRUSSES TO BE SPACED AT 24" O.C. UNLESS NOTED OTHERWISE. x ROOF PITCH at tall garage section IS TO BE 7:12 to match the house. x roof pitch at lower garage section is to be 3:12. x roof pitch at breezeway is to be 4:12 (3:12 would be okay as well). x roof pitch at elevator addition to be 3:12. x ROOFING MATERIAL IS to be standing seam metal. x OVERHANGS ARE as noted. x OVERHANGS ON GABLE ENDS ARE 12" SUPPORTED BY 2 X 4 OUTLOOKERS @ 4'-0" O.C. x FASCIA SHALL BE 5/4 x 6 (or match house) WITH CONTINUOUS METAL GUTTER. x BARGE RAFTERS SHALL BE 5/4 or 2 x 6 to match house. x ALL BEAMS & HEADERS TO BE 4 x 8 D.F. #2 UNO. x PROVIDE SOLID BLOCKING OVER SUPPORTS. x TRUSSES/RAFTERS TO BE SHEATHED WITH 7/16" cdx OR osb SHEATHING WITH 15# FELT OR BETTER. USE PLYWOOD SHEATHING ON ALL SOFFITED AREAS. x PROVIDE ROOF CROSS VENTILATION FOR EACH SEPARATE SPACE WHERE APPLICABLE. TRUSS NOTES x TRUSS MANUFACTURER SHALL PROVIDE DESIGN DETAILS AND ENGINEERING FOR ALL TRUSSES. COPY TO BE AVAILABLE ON SITE FOR FRAMING INSPECTIONS. x ALL TRUSSES SHALL CARRY THE MANUFACTURER'S STAMP. x ALL TRUSSES SHALL BE STORED, INSTALLED & BRACED PER MANUFACTURER'S SPECIFICATIONS. x TRUSSES SHALL NOT BE ALTERED IN THE FIELD WITHOUT THE APPROVAL OF THE BUILDING OFFICIAL AND/OR APPROVED ENGINEERING CALCULATIONS PROVIDED BY THE TRUSS MANUFACTURER. x ROOF TRUSSES TO BE SHEATHED WITH 7/16" cdx or osb SHEATHING WITH 15# FELT or better. USE PLYWOOD SHEATHING ON ALL SOFFITED AREAS. x PROVIDE ROOF CROSS VENTILATION FOR EACH SEPARATE SPACE where applicable.. ATTIC VENTILATION ATTIC VENTILATION REQUIRED. REFER TO IRC R806.1 AND R806.2. SQUARE FOOTAGE OF ATTIC SPACE FOR high garage section ROOF AREA = 518 S.F. SQUARE FOOTAGE OF ATTIC SPACE FOR lower garage section ROOF AREA = 350 S.F. SQUARE FOOTAGE OF ATTIC SPACE FOR breezeway ROOF AREA = 77 S.F. SQUARE FOOTAGE OF ATTIC SPACE FOR elevator addition ROOF AREA = 55 S.F. PROVIDE MIN. 1/150 OF ATTIC AREA, OR 1/300 IF HALF IS AT EAVE AND REMAINDER AT MIN. 3' ABOVE PLATE LINE. OPENINGS TO BE COVERED WITH 1/8" CORROSION RESISTANT METAL MESH OR EQUAL. EAVE OR CORNICE VENT SHALL NOT BE BLOCKED. MAINTAIN MIN. 1" AIR SPACE BETWEEN INSULATION AND ROOF SHEATHING AT THE LOCATION OF THE VENT. for open eave soffit use bird block truss blocking, with (3) 1 1/2" dia. holes and mesh screen covering the holes, between each truss. for closed eave soffit use continuous soffit venting. NOTE: ROOF TRUSSES SHOWN IN DRAWING ARE FOR SCHEMATIC PURPOSES ONLY. FOR TRUSS PLACEMENT, DESIGN AND ENGINEERING REFER TO TRUSS DESIGN & SPECIFICATIONS FROM TRUSS SUPPLY COMPANY. Approved 08/25/2023 HIGH POINT OF ROOF @ GARAGE TOP OF PLATE GARAGE @ HIGH SECTION TOP OF PLATE GARAGE @ LOW SECTION TOP OF SLAB GARAGE 10 ' - 0 " 14 ' - 0 " 18 ' - 6 1 / 4 " 12 7 12 3 8" overframing pre-manuf. standard trusses @ 24" o.c. breezeway (e) 2 x 4 rafters @ 24" o.c. (e) insulation (e) 2 x 4 rafters @ 24" o.c. (assumed) overframing pre-manuf. standard trusses @ 24" o.c. r-21 insulation 2 x 6 p.t. deck joists @ 16" o.c. concrete slab at elevator pit, 8" below floor level of platform and existing house. consult elevator manuf. for requirements optional insulation 2 x 6 studs @ 16" o.c. pre-manuf. standard trusses @ 24" o.c. optional insulation (e) crawl space (e) floor joists & insulation pre-manuf. mono trusses @ 24" o.c. w/ optional insulation r-49 insulation (elevator behind) (e) insulation 12 3 hold down stem wall to top of elevator pit slab 2 x 6 floor joists @ 16" o.c. w/ r-21 insulation for platform next to elevator 1' - 0 " (4) #4 EA. WAY 8" cptz or cbs or cbsq POST BASE 6 X 6 POSTsee s1 for footing size (2) #4 IN FOOTING p.t. bottom plate UNDISTURBED EARTH ANCHOR BOLTS @ 4'-0" O.C. see s1 for footing size 1' - 0 " 4 x 4 p.t. post simpson epb44phdg 12" x 12" precast pier pad compacted crushed stone base with fines 2 1 / 2 " M A X . GRADE 12 7 siding per elevations 7/16" cdx or osb SHEATHING hurricane tie @ ea. truss INSULATION OPTION 1/2" gwb OPTION 7/16" cdx or osb SHEATHING STANDING SEAM METAL ROOF pre-manuf. common trusses @ 24" o.c. 1/2" gwb OPTION 2 x 6 studs @ 16" o.c. CONT. METAL GUTTER 5/4 X 6 FASCIA or match house insulation baffle W/ 1" min. air space (AS NEEDED) 2x BLOCKING W/ (3) 1-1/2" DIA. SCREENED VENTS 8" OPTIONAL INSULATION siding per elevations 7/16" cdx or osb SHEATHING hurricane tie @ ea. truss insulation OPTION 1/2" gwb OPTION 7/16" cdx or osb SHEATHING standing seam metal roof pre-manuf. common trusses @ 24" o.c. 1/2" gwb OPTION 2 x 6 studs @ 16" o.c. CONT. METAL GUTTER 5/4 X 6 FASCIA OR MATCH HOUSE insulation baffle W/ 1" min. air space (AS NEEDED) 2x BLOCKING W/ (3) 1-1/2" DIA. SCREENED VENTS 1'-0" 3 12 OPTIONAL INSULATION hurricane tie @ ea. truss SOFFIT BOARD OR T&G DECKING 7/16" cdx or osb SHEATHING standing seam metal roof pre-manuf. common trusses @ 24" o.c. BEAM PER PLAN CONT. METAL GUTTER 5/4 X 6 FASCIA OR MATCH HOUSE 2x BLOCKING W/ (3) 1-1/2" DIA. SCREENED VENTS 1'-0" 4 12 BEAM WRAP (+/-) MATCH EAVES OF LOWER GARAGE SECTION siding per elevations 7/16" cdx or osb SHEATHING hurricane tie @ ea. truss R-49 INSULATION 1/2" gwb TYP. 7/16" cdx or osb SHEATHING standing seam metal roof pre-manuf. common trusses @ 24" o.c. 1/2" gwb TYP. 2 x 6 studs @ 16" o.c. CONT. METAL GUTTER 5/4 X 6 FASCIA OR MATCH HOUSE insulation baffle W/ 1" min. air space 2x BLOCKING W/ (3) 1-1/2" DIA. SCREENED VENTS 1'-0" 3 12 R-21 INSULATION 5*''61( A5 ,+/&70.#2 Ä ,+/",&&'5+)0&4#(6+0)%1/ BUILDING SECTION A - A 5%#.'Ä 4'8+5+105 BU I L D I N G S E C T I O N & D E T A I L S 24 1 , ' % 6 0' 9 ) # 4 # ) ' $ 4 ' ' < ' 9 # ; ' . ' 8 # 6 1 4 # & & + 6 + 1 0 5 ( 1 4 5 + 0 ) . ' Ä ( # / + . ; 4 ' 5 + & ' 0 % ' MC C O L L I S T E R G A R A G E & A D D I T I O N 5+ 6 ' # & & 4 ' 5 5 6 * 5 6 4 ' ' 6 #0 # % 1 4 6 ' 5 9 # 5 * + 0 ) 6 1 0 2# 4 % ' . 2 &4#90$; 5%#.' ,&,1$ ' ,#& #5016'& 4'Ä/%%1 2# ) ' & ' 5 % 4 + 2 6 + 1 0 THICKENED FOOTING 5%#.'Ä4 THICKENED FOOTING 5%#.'Ä5 DECK FOOTING 5%#.'Ä6 TRUSS/EAVE @ GARAGE 5%#.'Ä7 TRUSS/EAVE @ GARAGE 5%#.'Ä8 TRUSS/EAVE @ BREEZEWAY 5%#.'Ä9 TRUSS/EAVE @ ELEVATOR 5%#.'Ä Approved 08/25/2023 HIGH POINT OF ROOF @ GARAGE TOP OF PLATE GARAGE @ HIGH SECTION TOP OF PLATE GARAGE @ LOW SECTION TOP OF SLAB GARAGE HORIZONTAL LAP SIDING TO MATCH HOUSE FRIEZE TRIM TO MATCH HOUSE BARGE RAFTER TO MATCH HOUSE 11' W X 12' H O.H. DOOR 9' W X 8' H O.H. DOOR CORNER TRIM TO MATCH HOUSE BELLYBAND TO MATCH HOUSE 10 ' - 0 " 14 ' - 0 " 18 ' - 6 1 / 4 " 12 3 12 4 ELEVATOR ADDITION breezeway ADDITION 12 7 12 3 standing seam metal roof whole roof to be replaced with standing seam metal roofing HIGH POINT OF roof @ elevator addition approx. average grade @ addition 21 ' - 1 0 1 / 4 " 8" 1'-0" ELEVATOR ADDITION breezeway ADDITION 12 7 12 4 12 3 TOP OF PLATE @ elevator addition exist. top of plate @ sitting room top of floor (match exist.) top of beam @ breezeway top of floor 7' - 1 0 " 7' - 1 " 8' - 1 " (+ / - ) top of plate (match exist.) 9' - 1 " (+ / - ) (+ / - ) top of beam TO COORDINATE W/ meeting eaves of lower garage section HIGH POINT OF roof @ elevator addition approx. average grade @ addition 21 ' - 1 0 3 / 4 " 1'-0" TOP OF SLAB GARAGE TOP OF plate GARAGE @ high section 14 ' - 0 " HORIZONTAL LAP SIDING TO MATCH HOUSE CORNER TRIM TO MATCH HOUSE BELLYBAND TO MATCH HOUSE standing seam metal roofing 5/4 x 6 fascia or match house 5*''61( A6 ,+/&70.#2 Ä ,+/",&&'5+)0&4#(6+0)%1/ WEST ELEVATION 5%#.'Ä 4'8+5+105 EL E V A T I O N S N O R T H & W E S T 24 1 , ' % 6 0' 9 ) # 4 # ) ' $ 4 ' ' < ' 9 # ; ' . ' 8 # 6 1 4 # & & + 6 + 1 0 5 ( 1 4 5 + 0 ) . ' Ä ( # / + . ; 4 ' 5 + & ' 0 % ' MC C O L L I S T E R G A R A G E & A D D I T I O N 5+ 6 ' # & & 4 ' 5 5 6 * 5 6 4 ' ' 6 #0 # % 1 4 6 ' 5 9 # 5 * + 0 ) 6 1 0 2# 4 % ' . 2 &4#90$; 5%#.' ,&,1$ ' ,#& #5016'& 4'Ä/%%1 2# ) ' & ' 5 % 4 + 2 6 + 1 0 NORTH ELEVATION @ HOUSE #0&5'%6+106*417)*$4''<'9#; 5%#.'Ä NORTH ELEVATION @ GARAGE 5%#.'Ä Approved 08/25/2023 HIGH POINT OF ROOF GARAGE TOP OF PLATE GARAGE @ HIGH SECTION TOP OF PLATE GARAGE @ LOW SECTION TOP OF SLAB GARAGE HORIZONTAL LAP SIDING TO MATCH HOUSE FRIEZE TRIM TO MATCH HOUSE BARGE RAFTER TO MATCH HOUSE CORNER TRIM TO MATCH HOUSE BELLYBAND TO MATCH HOUSE 10 ' - 0 " 14 ' - 0 " 18 ' - 6 1 / 4 " 12 3 12 4 ELEVATOR ADDITION breezeway ADDITION 12 7 12 3 standing seam metal roofwhole roof to be replaced with standing seam metal roofing note: windows are not depicted at this elevation HORIZONTAL LAP SIDING TO MATCH HOUSE 12 4 TOP OF plate GARAGE @ high section TOP OF plate GARAGE @ low section TOP OF slab @ garage 10 ' - 0 " 14 ' - 0 " HIGH POINT OF ROOF @ GARAGE 18 ' - 6 1 / 4 " 5*''61( A7 ,+/&70.#2 Ä ,+/",&&'5+)0&4#(6+0)%1/ EAST ELEVATION 5%#.'Ä 4'8+5+105 EL E V A T I O N S S O U T H & E A S T 24 1 , ' % 6 0' 9 ) # 4 # ) ' $ 4 ' ' < ' 9 # ; ' . ' 8 # 6 1 4 # & & + 6 + 1 0 5 ( 1 4 5 + 0 ) . ' Ä ( # / + . ; 4 ' 5 + & ' 0 % ' MC C O L L I S T E R G A R A G E & A D D I T I O N 5+ 6 ' # & & 4 ' 5 5 6 * 5 6 4 ' ' 6 #0 # % 1 4 6 ' 5 9 # 5 * + 0 ) 6 1 0 2# 4 % ' . 2 &4#90$; 5%#.' ,&,1$ ' ,#& #5016'& 4'Ä/%%1 2# ) ' & ' 5 % 4 + 2 6 + 1 0 SOUTH ELEVATION @ HOUSE 5%#.'Ä SOUTH ELEVATION @ GARAGE #0&5'%6+106*417)*$4''<'9#; 5%#.'Ä Approved 08/25/2023 HW note: windows are not depicted at this elevation 5*''61( A8 ,+/&70.#2 Ä ,+/",&&'5+)0&4#(6+0)%1/ 4'8+5+105 EX I S T I N G F L O O R PL A N S & E L E V A T I O N S 24 1 , ' % 6 0' 9 ) # 4 # ) ' $ 4 ' ' < ' 9 # ; ' . ' 8 # 6 1 4 # & & + 6 + 1 0 5 ( 1 4 5 + 0 ) . ' Ä ( # / + . ; 4 ' 5 + & ' 0 % ' MC C O L L I S T E R G A R A G E & A D D I T I O N 5+ 6 ' # & & 4 ' 5 5 6 * 5 6 4 ' ' 6 #0 # % 1 4 6 ' 5 9 # 5 * + 0 ) 6 1 0 2# 4 % ' . 2 &4#90$; 5%#.' ,&,1$ ' ,#& #5016'& 4'Ä/%%1 2# ) ' & ' 5 % 4 + 2 6 + 1 0 EXIST. WEST ELEVATION 5%#.'Ä EXIST. MAIN FLOOR PLAN 5%#.'Ä01 4 6 * EXIST. UPPER FLOOR PLAN 5%#.'Ä01 4 6 * EXIST. EAST ELEVATION 5%#.'Ä EXIST. NORTH ELEVATION 5%#.'Ä EXIST. SOUTH ELEVATION 5%#.'Ä Approved 08/25/2023 Tim K. Garrison, P.E. 2316 Antone Way Anacortes, WA 98221 360-708-1865 timg@timkgarrison.com S1 of 3 Foundation Plan TKG Job No.: t23035 Date: 7/11/23 Rev: Rev: Rev: Client: John McCollister Architectural Design: Jim Dunlap Ne w G a r a g e a n d A d d i t i o n t o H o u s e a t 11 2 0 4 t h S t . , A n a c o r t e s , W A Structural Callouts© – Copyright ConstructionCalc, Inc (CCI) 0 PA Per Architect or Designer * Structural Item: This item and related connectors shall be per architect or designer. 8 SW Simpson Wood Shear Wall Detail * Wood Shear Wall: Use WSW18. Width = 18". Height, see below.D8 *Height: Top of stemwall to bottom of header beam. Okay to order WSW long and cut to height as necessary. *Alignment: Position to align with outside (exterior) face of studs. Furr-out as necessary to flush up with remainder of wall. *Top Connection: Header beam to extend over entire WSW. Connect with portal straps WSW-PS. Also connect header beam to WSW with WSW-TOW portal plate. * Sheathing: Sheathe header, WSW, and wall similar to 2PW. * Bottom Connection: Anchor bolts, use all-thread, 7/8" diameter, extended to footing bottom rebar and use double nut and 3" x .25" washer on embedded end. Suggest using Wood Strong Wall Anchor Bolt template, SSW. 12 FD Floor Diaphragm * Sheathing: With joists at 24" or 19.2" OC, use min., 24 oc rated, APA Sturd-I-Floor; either 3/4" species group 1, or 7/8" species group 4. May be OSB or plywood. * Sheathing: With joists at 16" OC, use min., 16 oc rated, APA Sturd-I-Floor, min., 19/32" thick. May be OSB or plywood. Good for 245 psf TL @ L/360 defl. * Sheathing Layout: Case 1 per IBC 2306.2.1(1) - Orient sheets continuous over two or more spans, with the long dimension across supports. * Nailing: Glue, and connect with 8d ring shank nails or screws, at 6" edges, 12" field. * Blocking: not required except at supports (beams) and connections to shear walls below. 81 L Ledger - Deck Joists to Rim or Studs. *Ledger: Use min., 2x, PT ledger at least as tall as joists. * Ledger Connection: Connect to studs or solid framing with SDS or LedgerLOK with length necessary for 1.5" min. penetration into supporting framing, at the following spacing. May be applied directly to framing or to sheathing over framing. Do not apply over siding - remove any siding as necessary. -Joists or rafters parallel, use 1 @ 24" max spacing and within 3" of splices and ends. -Joists or rafters perpendicular , use 1 @ 16" or 2 @ 24", max spacing and within 3" of splices and ends. *Joist Connection: Connect joist to ledger with galv hanger, all holes filled with galv nails or screws per hanger manufacturer recommndation. 90 FC Footing, Continuous * Retained Height: Maximum retained height (unbalanced fill) = 4'. * Stepping: Okay to step this footing as necessary for grade changes. All footing longitudinal rebar shall continue through step, okay to bend 90 degrees at direction changes. * Footing: Use min., 16" wide x 8" tall. -Longitudinal reba r, use 2, #4 continuous, 3" from bottom. * Stemwall: Use min 5.5" thick. -Vertical rebar , use #4 at all corners, wall ends, intersections, and at 24" OC, max, centered in wall, with alternating 6" bends at bottom footing rebar. -Horizontal rebar , #4 top and bottom and at 24" OC max., centered. -At doors , stemwall may be shortened or omitted. -Crawl openings 24" wide or less in stemwalls are permitted where no significant point loads from above occur. *Drains: Install footing drains and / or downspout drains per others and as required by code. 94 FP Footing, Pad * Footing: Use min., 28" square x 8" tall. -If in slab area, footing may be mono-poured with slab or below slab. Height may include slab height if poured monolithically. *Rebar: Use 3, #4 each way, 3" from bottom. 95 S Slab on Grade * Subgrade: Use structural fill or native material, compacted to 95% relative compaction. It is strongly recommended that all structural fill be checked by a geotechnical consultant. *Underslab Insulation: May use XPS or EPS rigid foam with min., 25 psi compressive strength under slab. If used, provide and install per insulation manufacturer's recommendations. * Slab Thickness: Use 4" min. May thicken at edges and use additional continuous rebar in thickend portion, though not required. * Reinforcement: Use any of the following: - Min., #3 rebar at 24" OC, each way, centered in slab. - Welded wire fabric, min., W2.9, 6"x6" (6 Ga.), centered in slab. Splices overlap 8" min. - Fibermesh per manufacturer's recommendation. - Helix micro rebar, min., 5 lbs. per cubic yard. * Control Joints: Maximum recommended spacing = 8' OC, each way. This is a non-structural item and may be changed or omitted by Owner or architectural designer. * Vapor Barrier: Suggest a min., 6 mil., plastic vapor barrier under interior slabs. This is a non- structural item and may be changed or omitted by Owner or architectural designer. 97 VF Verify Foundation * General: At new or increased point load from above verify that there is an existing footing in good condition directly below, with solid blocking through floor cavity. If in doubt contact project engineer, Tim Garrison, PE, 360-708-1865. General: All construction shall be per current building code and Standard Structural Specifications herein. 24 7/11/23 Approved 08/25/2023 Tim K. Garrison, P.E. 2316 Antone Way Anacortes, WA 98221 360-708-1865 timg@timkgarrison.com S2 of 3 Structural Plan TKG Job No.: t23035 Date: 7/11/23 Rev: Rev: Rev: Client: John McCollister Architectural Design: Jim Dunlap Ne w G a r a g e a n d A d d i t i o n t o H o u s e a t 11 2 0 4 t h S t . , A n a c o r t e s , W A Call- out Capa- city, wind/ seis, Eh, plf Sheath- ing, min. Sides of wall Nails or screws, size Stud height, max., ft. Stud spac'g, max., in. Nominal stud size, min. Stud mat'l (see std st'l specs) Nail Edge / Field spac'g @ Stud spac'g, in. Top Plate, min. Top plate splice, min. Sill plate & studs w/ edge nail'g, min. Block- ing at unsup- ported edges, min. Top of wall to parallel framing or rim or rim blk'g. Top of wall to perpen- dicular framing. Bottom plate to framing. Mud sill anchor to concrete Conc. anchor max spc'g, w/ 4" min embed Detail Detail Detail 10 24 2x4 or larger per Arch Sawn 6/6@24 6/12@16 15 16 2x6 Sawn 6/12@16 19 12 2x6 Sawn or LVL 6/12@12 2PW 490/ 350 (same) (same) (same) (same) 16 (same) (same) 4/12@16 or @12 (same) (same) (same) 2x (same) (same) Con't sht'g or 16d@3" or 4.5" SDS @ 6" (same) 42" Structural Shear Wall Callouts© – Copyright ConstructionCalc, Inc (CCI) 1PW 168/ 120 7/16" OSB or plywo- od, orient either dir. one, either side, apply directly to studs 8d 2- 2x 48" lap w/ 10- 16d 2x NA Con't sheathing or A34 or LTP4 at 36" max. Con't sheathing +blkg, or H2.5, or SDWC- 15600, @ 24" max Con't sheathing or 16d @ 6" or 4.5" SDS @ 12". 5/8" j-bolt or 5/8" Titen HD, w/ 3" wshr. Or MASA or MASAP 72" Typical Shear Wall Callout Symbol Min. length of shear panel, ft. If "W", construct entire Wall per this callout, with minimum individual panel lengths indicated on plan. This symbol indicates a dedicated shear wall or panel, the type per callout below. Walls without this symbol, or labled "NS" are not dedicated shear walls - use code-standard construction.3.4 1 PW D1 D2 D3 Callout Min, use Alt 1 min. use Alt 2 min., use Trimmer, each end (if blank use default above.) King Stud, each end (if blank use default above.) 20H 2x6, "L" config 4x6 21H 2x10, "L" config 2- 2x8 4x8 22H 23H Callout Min., use Alt 1 min., use Alt 2 min., use Connector (if blank use default, above)Notes 30B 31B 5.5x10.5 gl 32B 4x8 33B 4x6 40B 2, 2x8 4x8 3, 2x6 Callout Min., use Alt 1 min., use Alt 2 min., use Connector (if blank use default, above)Notes Callout Min., use Alt 1 min., use Alt 2 min., use Connector (if blank use default, above)Notes 70P 2- 2x4 4x4 71P 3- 2x4 2- 2x6 4x6 72P 3- 2x6 6x6 4- 2x4 Use 6x10 full width of wall, ~14' long. Bear on top of 8SW per plan and that callout. Connect studs to 22H with A23 and screws, typ. Sim to 22H except ~11.5' long. Butt into side of 31B. Headers Default header material is Doug Fir No. 2 or better 2x headers must be in tall orientation with flat 2x nailed at bottom in "L" configuration Default Trimmer, use 1, 2x; or 20H or 21H use LUC; larger header use HUC or HUCQ, UNO. Default King Stud, opening 6-feet wide and less use 1, full height stud each end (plate to plate.) Default King Stud, opening wider than 6-feet, use 2, full height studs each end (plate to plate.) Beams Default sawn material is Doug Fir No 2 or better. Default glulam (gl), LVL, PSL materials - see Standard Structural Specs herein. Default LSL is 1.5E, 2,300 psi, min Fb. Default wall connection: 3" bearing in pocket or on plate with min., 2 studs below. Default end post connection: LCE, ACE, EPCZ, ECCQ, or similar. Default corner post connection with mitered beams over: LCE4, LCE4Z, or RTC44. Default mid-post connection: LPCZ, PCZ, CCQ, or similar. Default bottom connection on concrete: PB, or AB, or ABU, or ABW, or CBSQ Blocking through floor cavity: Use solid blocking through floor cavity. Blocking to be similar to post above. Blocking may be connected with clips, nails, screws, cleats, or similar. Joists and Rafters Posts Default bottom connection on plate: 2, A23 with TECO or screws, or 4, 16d face nails. I-Joist roof overhangs, extensions, outriggers, and cantilevers shall per per manufacturer's recommendations. Default I-joist face mount hanger is IUS or MIU (All joists and rafters are per Arch. Use defaults, above, as appropriate.) Use Pressure Treated (PT) where exposed to weather or in contact with concrete. Default sawn material is Doug Fir No 2 or better. PT may be Hem Fir #2 & better. (see main callouts) Default bottom connection on beam: 2, A23 with TECO or screws, or PCZ. Default rafter or deck joist to beam connection is con't or skip blocking and H2.5A, or H1, or A34 with screws. Framed roof overhangs, eaves, outriggers, etc. use IRC-compliant construction. Default sawn material is Doug Fir No 2 or better. Exposed to weather shall be Pressure Treated (PT) Default sawn face mount hanger is U, LU, LUS, or if sloped rafter use LRUZ. Default I-joist top flange hanger is ITS, HIT, or MIT Default sawn top flange hanger is JBA, LB, BA, or B (welded app, use LB, BA, or B) Any national I-joist brand, equal or stronger may be substituted Structural Callouts© – Copyright ConstructionCalc, Inc (CCI) 0 PA Per Architect or Designer * Structural Item: This item and related connectors shall be per architect or designer. 8 SW Simpson Wood Shear Wall Detail * Wood Shear Wall: Use WSW18. Width = 18". Height, see below.D8 *Height: Top of stemwall to bottom of header beam. Okay to order WSW long and cut to height as necessary. *Alignment: Position to align with outside (exterior) face of studs. Furr-out as necessary to flush up with remainder of wall. *Top Connection: Header beam to extend over entire WSW. Connect with portal straps WSW-PS. Also connect header beam to WSW with WSW-TOW portal plate. * Sheathing: Sheathe header, WSW, and wall similar to 2PW. * Bottom Connection: Anchor bolts, use all-thread, 7/8" diameter, extended to footing bottom rebar and use double nut and 3" x .25" washer on embedded end. Suggest using Wood Strong Wall Anchor Bolt template, SSW. 9 VF OverFraming - Roof * General: To minimize the new dead load on the existing roof, remove the existing roofing material under the new overframing. Leave existing plywood or OSB sheathing in place for diaphragm purposes. *Ridge: Use min., 2x6 supported with vertical kickers at 6-ft max spacing. One end of ridge may be supported on valley boards. * Ridge Support Posts: max spacing = 6 ft. If bearing on roof sheathing between trusses or rafters, bear on min., 2x4 block connected to at least two trusses or rafters. Use the following size depending on post length: - Length = 0 to 6 ft., use 2x4 *Rafters: Max spacing = 2 ft. Connect to ridge with face nails, or A34 clip, or hanger. Connect to valley board with A34 clip. Use the following size depending on true length rafter span: - Span = 0 to 7 ft., use min., 2x4. - Span = 7.1 to 10 ft, use min., 2x6. * Valley: Use min., 2x8 flat. Connect to each truss or rafter with min., 3- 16d. * Roof Sheathing: Use 11RD. 11 RD Roof Diaphragm *Framing: Trusses or rafters at 24” OC, max. * Overhangs: Per code and truss or I-joist manufacturer's recommendations. * Framing Connection at Support: -Where connected to shear wall , connect per shear wall callout - top of wall. -Where trusses or rafters connect to beam , use H2.5A, or LS30 with screws, or similar, typ. * Sheathing: 7/16” min., OSB or CDX plywood. Stagger joints per IBC, Case 1. * Nailing: Use 8d at 6" edges, 12" field. -At ledger , connect per ledger callout, but never less than 8d screw or ring shank at 4" OC. * Blocking: Not required except between trusses or rafters at their supports. 12 FD Floor Diaphragm * Sheathing: With joists at 24" or 19.2" OC, use min., 24 oc rated, APA Sturd-I-Floor; either 3/4" species group 1, or 7/8" species group 4. May be OSB or plywood. * Sheathing: With joists at 16" OC, use min., 16 oc rated, APA Sturd-I-Floor, min., 19/32" thick. May be OSB or plywood. Good for 245 psf TL @ L/360 defl. * Sheathing Layout: Case 1 per IBC 2306.2.1(1) - Orient sheets continuous over two or more spans, with the long dimension across supports. * Nailing: Glue, and connect with 8d ring shank nails or screws, at 6" edges, 12" field. * Blocking: not required except at supports (beams) and connections to shear walls below. 30 B Beam, Retrofit in Existing Attic Detail *Beam: Use min., 5.5x6 glulam. Mitre cut top corners to fit snugly under existing roof sheathing. Okay to splice over middle wall.D30 *Connection to Wall: Bear on full width of existing top plate and connect with 2, A23 and screws. Ensure at least one stud directly below each 30B bearing location, add stud if necessary. * Connection to New Posts. At existing hips and under new dormer ridge, use 70P to support existing roof framing. Add 4x blocking between existing rafters as necessary. Connect 70P to top of 30B with A23 and screws. 80 L Ledger - Roof Diaphragm * Ledger Connection to Wall: - Rafters Perpendicular: Use 2x or LVL ledger, min height to match rafters. Apply ledger over wall sheathing. If connecting ledger to rim or header or other continuous wood, use SDS at ends, splices, and max 16" spacing. If connecting to studs, use 1, SDS per stud. Use hangers to hang rafters on ledger. - Parallel Rafter or Truss Top Chord: Ledger may be top chord of last truss or rafter. Ledger to be placed over wall sheathing. If connecting ledger to rim or header or other continuous wood, use SDS at ends, splices, and max 24" spacing. If connecting to studs, use 1, SDS per stud. - Parallel Rafter or Truss Top Chord To Gable Truss: Ledger may be top chord of last truss or rafter. Ledger to be placed over wall sheathing over gable truss. Connect ledger to gable truss members with 3.5" SDS at 24" max spacing. o Gable truss to be sheathed with 1PW, similar. Add webs to gable truss as necessary. Okay to cut holes in sheathing for ducts, utilities and access. - Mono Truss Perpendicular: At top of mono truss, use continuous 2x blocking between truss tops nailed through wall sheathing to solid backing. At bottom chord, support mono truss on let-in ledger nailed to studs, or on hangers similar to Rafters Perpendicular, above. *Roof Diaphragm: Connect roof diaphragm to ledger (or continuous blocking at perpendicular mono truss top chord) with 8d ring shank or screws at 3" OC. General: All construction shall be per current building code and Standard Structural Specifications herein. 24 7/11/23 Approved 08/25/2023 Tim K. Garrison, P.E. 2316 Antone Way Anacortes, WA 98221 360-708-1865 timg@timkgarrison.com S3 of 3 Standard Structural Specifications TKG Job No.: t23035 Date: 7/11/23 Rev: Rev: Rev: Client: John McCollister Architectural Design: Jim Dunlap Ne w G a r a g e a n d A d d i t i o n t o H o u s e a t 11 2 0 4 t h S t . , A n a c o r t e s , W A 24 7/11/23 Approved 08/25/2023 Version Date: August 30, 2022 Storm Water Drainage Report Minimum Requirements 1 through 5 Minimum Requirement 1 through 9 ENGINEERING DEPARTMENT 904 6th Street Anacortes, WA 98221 www.anacorteswa.gov Official Use Only: (Information to Inspectors) Required Storm Water Facility and other related requirements: ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ Project Address: ________________ Submittal Date: __________________ Parcel Number: ________________ Revision Number: ________________ Permit Number: ________________ Reviewer: _______________________ Acceptance Date (COA):____________ FRONT OF REPORT: Submittal Checklist: (All items listed below are required for a complete submittal) o Cover Sheet (Preparer to Provide): Project title, Location, Revision dates, Engineer’s Stamp o TAB 1: Minimum Requirement #1 – Preparation of Stormwater Site Plans o TAB 2: Minimum Requirement #2 – Construction Stormwater Pollution Prevention (SWPP) o TAB 3: Minimum Requirement #3 – Source Control of Pollution o TAB 4: Minimum Requirement #4 – Preservation of Natural Drainage Systems and Outfalls o TAB 5: Minimum Requirement #5 – On-site Stormwater Managements o TAB 6: Minimum Requirement #6 – Runoff Treatment o TAB 7: Minimum Requirement #7 – Flow Control o TAB 8: Minimum Requirement #8 – Wetland Protection o TAB 9: Minimum Requirement #9 – Operation and Maintenance o APPENDIX 1 - Survey performed by a Professional Land Surveyor o APPENDIX 2 - Soils Analysis (Volume 1, Chapter 3.1.1) o APPENDIX 3 - Model Soil Management Plan for BMP T5.13 o APPENDIX 4 - Determining Construction Site Sediment Damage Potential (Appendix 7) o APPENDIX 5 - Site Plan with all applicable information (Minimum Size 11x17 – 30 scale) o APPENDIX 6 - Documented Site Photos (North, South, East and West) o APPENDIX 7 - Drainage BMP Facility Maintenance Covenant, if applicable. To be recorded prior to the Temporary Certificate of Occupancy, Certificate of Occupancy or Final Acceptance. o APPENDIX 8 – Maintenance and Operations Manual Stormwater Management Requirements: o Refer to the 2019 Department of Ecology Manual o See also, City of Anacortes Municipal Code 19.76 for additional information o See also, current Engineering Development Standards, Chapter 2- Storm Drainage for additional information. WK6WUHHW 3 Version Date: August 30, 2022 Project Description and Summary: Summary Table Existing Proposed Development Type Number of Lots Lot Acreage in SF Soil Type(s) Site Sediment Transport Score (High\Low) Depth to Ground Water Table (Feet and Inches) (See completed Soils Analysis (Volume 1, Chapter 3.1.1) Infiltration Rate during Rainy Season (Inch\Per Hour) Impervious Surface (on-site) Impervious Surface (off-site) New and Replaced Hard Surface Total (SF) Lot Coverage (Percentage) BMP (Required Minimum Requirement 5) BMP T5.13 Post Construction Soils Water Quality Method (Minimum Requirement 6) Water Quantity Method (Minimum Requirement 7) Existing Site Conditions Summary: (Additionally, provide information on previous permits, if any, like Grade and Fill, Clear and Grade, topography, vegetation, drainage, Critical Areas adjacent to the site and how it may affect this project if soils are disturbed, Soils Type (Included in Soils Analysis Report), Erosion Problem Areas, Construction Phasing\Sequence ) ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ Developed Conditions Summary: (Additionally, to be shown on the site plan. Identify cut and fill areas, proposed slopes of all hard surfaces , proposed contours) ________________________________________________________________________________ ________________________________________________________________________________ ________________________________________________________________________________ ________________________________________________________________________________ ________________________________________________________________________________ ________________________________________________________________________________ Drainage Basin (2007 Storm Comp Plan – City website\publicworks\engineering\comprehensive plans): What Drainage Basin are you in? _________ Identify any downstream drainage issues (Storm Comp Plan: _________ If so, describe: ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ Complete the Applicability Requirements – Flow Chart (See next page(s) -Highlight the path and attach VI VIVI WRWDO 7KHUHLVDQH[LVWLQJKRPHRQWKHVLWH1RFKDQJHLQVLWHJUDGHVDUHSURSRVHGQRUHWDLQLQJZDOOVDUHSURSRVHG 7KHUHZLOOEHOLWWOHH[FDYDWLQJUHTXLUHGDVERWKWKH$GGLWLRQDQG*DUDJHZLOOEHRQVODE7KHUHDUHQRFULWLFDO DUHDVQHDUWKHVLWH +DUGVXUIDFHVZLOOKDYHOLWWOHVORSHDVORWLVSUHWW\IODW1RILOODUHDVDUHSURSRVHG7KHUHZLOOEH VRPHFXWIRUIRRWLQJVDURXQGVODEEXWQRFUDZOVSDFHVDUHSURSRVHG G-18 No known problems Version Date: August 30, 2022 Version Date: August 30, 2022 Version Date: August 30, 2022 TAB 1 (MINIMUM REQUIREMENT #1) x 1-3.4.1 Minimum Requirement #1 – Prepare a Stormwater Site Plan -III.3.2 – Preparation of a Stormwater Site Plan Note: The level of detail needed for each step depends upon the project size. Provide a narrative description of each step. Step 1 – Analyze Existing Stie Conditions to Determine LID Feasibility The existing site analysis is intended to determine the pre-development conditions on the site in addition to determining the appropriateness for use of Low Impact Development (LID) techniques. Site conditions as identified in this step will determine the feasibility of the overall stormwater design including use of LID techniques. The development context shall be established by an existing site analysis consistent with the requirements detailed in this Step. The initial inventory and analysis process will provide baseline information necessary to design strategies that utilize areas most appropriate to evaporate, transpire, and infiltrate stormwater, and achieve the goal of mimicking the pre-development natural hydrologic conditions on the site. The existing site analysis shall include, at a minimum, the following information: 1. A survey prepared by a registered land surveyor, civil engineer, or other qualified professional showing: (See this section for additional items to include) 2.A soils report prepared by a professional soil scientist certified by the Soil Science Society of America (or an equivalent national program), or by other suitably trained persons working under the supervision of a professional engineer, geologist, hydrogeologist, or engineering geologist registered in the State of Washington. _____________________________________________________________________________ _____________________________________________________________________________ _____________________________________________________________________________ _____________________________________________________________________________ _____________________________________________________________________________ _____________________________________________________________________________ Step 2 - Prepare Preliminary Development Layout Based upon the existing site analysis results, locate the buildings, roads, parking lots, landscaping features, LID BMPs, and preliminary location of Runoff Treatment and Flow Control BMPs for the proposed development. Consider the following points when laying out the site: x Fit development to the terrain to minimize land disturbance; confine construction activities to the least area necessary, and away from critical areas. x Preserve areas with natural vegetation (especially forested areas) as much as possible. x On sites with a mix of soil types, locate impervious areas over less permeable soil (e.g., till), try to restrict development over more porous soils or take advantage of them by locating bioretention, rain gardens and/or permeable pavement over them. x Cluster buildings together. x Minimize impervious areas. x Maintain and utilize the natural drainage patterns. _____________________________________________________________________________ _____________________________________________________________________________ _____________________________________________________________________________ _____________________________________________________________________________ Version Date: August 30, 2022 _____________________________________________________________________________ _____________________________________________________________________________ Step 3 - Perform Off-site Analysis City of Anacortes requires an off-site analysis for projects that add 5,000 SF or more of new hard surfaces, or convert ¾ acres of vegetation to lawn or landscape areas, or convert 2.5 acres of forested area to pasture. Off-site analysis extends to ¼ mile downstream of the project site. _____________________________________________________________________________ _____________________________________________________________________________ _____________________________________________________________________________ _____________________________________________________________________________ _____________________________________________________________________________ _____________________________________________________________________________ Step 4 – Determine and Read the Applicable Minimum Requirements (Place at the front end of the document before MR#1) I-3.3 Applicability of the Minimum Requirements establishes project thresholds for the application of Minimum Requirements to new development and redevelopment projects. Figure I-3.1: Flow Chart for Determining Requirements for New Development (Included in the report) and Figure I-3.2: Flow Chart for Determining Requirements for Redevelopment (Included in the report) provide the same thresholds in a flow chart format. Based on the preliminary layout, determine whether Minimum Requirements #1 and #2 only apply to the project, or #1 through #5 only apply to the project, or #1 through #9 apply. _____________________________________________________________________________ _____________________________________________________________________________ _____________________________________________________________________________ _____________________________________________________________________________ _____________________________________________________________________________ _____________________________________________________________________________ Step 5 - Prepare a Permanent Stormwater Control Plan (Place in Appendix 5 of this report) (Due to the extent of required information for this section, refer to this section of the Ecology Manual for requirements.) _____________________________________________________________________________ _____________________________________________________________________________ _____________________________________________________________________________ _____________________________________________________________________________ _____________________________________________________________________________ _____________________________________________________________________________ Version Date: August 30, 2022 Step 6 - Prepare a Construction Stormwater Pollution Prevention Plan (Place in MR#2 – 13 Elements) The Construction SWPPP for projects adding or replacing 2,000 square feet of hard surface or more, or clearing 7,000 square feet or more, must contain sufficient information to satisfy the local government Plan Approval Authority that the potential pollution problems have been adequately addressed for the proposed project. Local governments may adopt a standard SWPPP format for use by projects less than 1 acre. An adequate Construction SWPPP includes a narrative and drawings. The narrative is a written statement to explain and justify the pollution prevention decisions made for a particular project. The narrative contains concise information concerning existing site conditions, construction schedules, and other pertinent items that are not contained on the drawings. The drawings and notes describe where and when the various BMPs should be installed, the performance the BMPs are expected to achieve, and actions to be taken if the performance goals are not achieved. See II-2.4 Preparing Construction SWPPPs for details about what to include in the project's Construction SWPPP. ___________________________________________________________________________ ___________________________________________________________________________ ___________________________________________________________________________ ___________________________________________________________________________ ___________________________________________________________________________ ___________________________________________________________________________ Step 7 - Complete the stormwater site plan The Stormwater Site Plan encompasses the entire submittal to the Local Agency with drainage review authority. Refer to this section of the Manual for further clarification of each item and what is required. See below: A.Project Overview (Front End) B. Existing Conditions Summary (Front End) C.Off-site Analysis Report (Minimum Requirement 1, Step 3) D.Permanent Stormwater Control Plan (Appendix 5) E. Construction Stormwater Pollution Prevention Plan (Minimum Requirement 2) F. Special Reports and Studies (Survey – Appendix 1, Geotechnical – Appendix 2, all others placed after Appendix 8) G.Other Permits, if applicable H.Operation and Maintenance Manual (Appendix 8) I.Declaration of Covenant for Privately Maintained Flow Control and Treatment Facilities. (See attached Drainage BMP Maintenance Covenant BMP Agreement) (Appendix 7) J. Declaration of Covenant for Privately Maintained On-site Stormwater BMP’s (See attached Drainage BMP Maintenance Covenant BMP Agreement) (Appendix 7) K. Bond Quantities Worksheet, if applicable _____________________________________________________________________________ _____________________________________________________________________________ _____________________________________________________________________________ _____________________________________________________________________________ _____________________________________________________________________________ _____________________________________________________________________________ Version Date: August 30, 2022 Step 8 - Check Compliance with all Applicable Minimum Requirements Before Submitting this report, a Stormwater Site Plan as designed and implemented should specifically fulfill all Minimum Requirements applicable to the project. The Stormwater Site Plan should be reviewed to check that these requirements are satisfied. Note: The report will be returned if determined incomplete. _____________________________________________________________________________ _____________________________________________________________________________ _____________________________________________________________________________ _____________________________________________________________________________ _____________________________________________________________________________ _____________________________________________________________________________ Version Date: August 30, 2022 TAB 2 (MINIMUM REQUIREMENT #2) x 1-3.4.2 Minimum Requirement #2 – Construction Stormwater Pollution Prevention Plan (SWPP) All new development and redevelopment projects are responsible for preventing erosion and discharge of sediment and other pollutants into receiving waters. Projects which result in 2,000 square feet or more of new plus replaced hard surface area, or which disturb 7,000 square feet or more of land must prepare a Construction Stormwater Pollution Prevention Plan (SWPPP) as part of the Stormwater Site Plan (see MR1: Preparation of Stormwater Site Plans). Projects below those thresholds (listed above) are not required to prepare a Construction SWPPP, but must consider all of the Construction SWPPP Elements (listed below) and develop controls for all Construction SWPPP Elements that pertain to the project site. General Requirements: The Construction SWPPP shall include a narrative and drawings. All BMPs shall be clearly referenced in the narrative and marked on the drawings. The Construction SWPPP narrative shall include documentation to explain and justify the pollution prevention decisions made for the project. Each of the 13 Construction SWPPP Elements (listed below) must be considered and included in the Construction SWPPP unless site conditions render the Element unnecessary and the exemption from that Element is clearly justified in the narrative of the SWPPP. Clearing and grading activities for developments shall be permitted only if conducted pursuant to an approved site development plan (e.g., subdivision approval) that establishes permitted areas of clearing, grading, cutting, and filling. These permitted clearing and grading areas and any other areas required to preserve critical or sensitive areas, buffers, native growth protection easements, or tree retention areas, shall be delineated on the site plans and the development site. The Construction SWPPP shall be implemented beginning with initial land disturbance and until final stabilization. Sediment and Erosion control BMPs shall be consistent with the BMPs contained in II-3 Construction Stormwater BMPs. Seasonal Work Limitations: From October 1 through April 30, clearing, grading, and other soil disturbing activities shall only be permitted if shown to the satisfaction of the local permitting authority that silt-laden runoff will be prevented from leaving the site through a combination of the following: 1. Site conditions including existing vegetative coverage, slope, soil type and proximity to receiving waters; and 2.Limitations on activities and the extent of disturbed areas; and 3. Proposed erosion and sediment control measures. The following activities are exempt from the seasonal clearing and grading limitations: 1. Routine maintenance and necessary repair of erosion and sediment control BMPs, 2. Routine maintenance of public facilities or existing utility structures that do not expose the soil or result in the removal of the vegetative cover to soil, and 3.Activities where there is one hundred percent infiltration of surface water runoff within the site in approved and installed erosion and sediment control facilities. Version Date: August 30, 2022 [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ [ Version Date: August 30, 2022 [ [ [ Version Date: August 30, 2022 [ [ Version Date: August 30, 2022 [ [ [ [ [ Version Date: August 30, 2022 [ Version Date: August 30, 2022 13 Elements of SWPPP (Construction Stormwater Pollution Prevention Plan) Please check off boxes to show that each element has been read and understood. Provide details where applicable and if certain aspects are unnecessary or exempt, clearly justify. Details of the 13 Elements and the correlating BMPs are listed Above from the 2019 Stormwater Management Manual for Western Washington (SWMMWW). A link is provided on the City of Anacortes website, under Planning, Community, & Economic Development Department, as well as under Stormwater on the Engineering Division of Public Work’s page. Owner Name:____________________________________________ Site Address:_____________________________________________ Prepared By:_____________________________________________ The Stormwater checklist or building permit determined that: The 13 elements must be addressed for construction activity adding under 2,000 sq. ft. of hard surface area. These elements must be addressed for construction activity adding 2,000 sq. ft. or more of hard surface area. This means that an attached narrative and site plan are required with this document. Under each element, provide the BMP’s that will be applicable to your project. Use the attached Tables provided. ELEMENT 1: Preserve Vegetation/Mark Clearing Limits Before beginning land disturbing activities, including clearing and grading, clearly mark all clearing limits, sensitive areas and their buffers, and trees that are to be preserved within the construction area. Retain the duff layer, native top soil, and natural vegetation in an undisturbed state to the maximum degree practical. Suggested BMPs for Element 1: x BMP C101: Preserving Natural Vegetation x BMP C102: Buffer Zones x BMP C103: High-Visibility Fence x BMP C233: Silt Fence How did you comply with this section? ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ -RKQ0F&ROOLVWHU WK6W -LP'XQODS [ [ [ %03&+LJKYLVLELOLW\IHQFHWRPDUNFRQVWUXFWLRQ]RQHDQGSURWHFWYHJHWDWLRQ %03&6LOW)HQFHWREHLQVWDOOHGRQGRZQVORSHVLGHVRIFRQVWUXFWLRQ]RQHWR SURWHFWDJDLQVWHURVLRQDQGDOVRWRKHOSPDUNFRQVWUXFWLRQ]RQHDQGRUFOHDULQJ OLPLWV Version Date: August 30, 2022 ELEMENT 2: Establish Construction Access Limit construction vehicle access and exit to one route, if possible. Stabilize access points with a pad of quarry spalls, crushed rock, or other equivalent BMPs, to minimize tracking onto roads. Locate wheel wash or tire baths on site, if the stabilized construction entrance is not effective in preventing tracking sediment onto roads. If sediment is tracked off site, clean the affected roadway thoroughly at the end of each day, or more frequently as necessary (ex: wet weather). Remove sediment from roads by shoveling, sweeping, or pick up and transport the sediment to a controlled sediment disposal area. Conduct street washing only after sediment is removed in accordance with the above bullet. Control street wash wastewater by pumping back on site or otherwise preventing it from discharging into systems tributary to waters of the State. Additional Guidance for Element 2 Minimize construction site access points along linear projects, such as roadways. Street washing may require local jurisdiction approval. Suggested BMPs for Element 2: x BMP C105: Stabilized Construction Access x BMP C106: Wheel Wash x BMP C107: Construction Road / Parking Area Stabilization How did you comply with this section? ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ELEMENT 3: Control Flow Rates Protect properties and waterways downstream of development sites from erosion and the associated discharge of turbid waters due to increases in the velocity and peak volumetric flow rate of stormwater runoff from the project site. Where necessary to comply with the bullet above, construct stormwater retention or detention facilities as one of the first steps in grading. Assure that detention facilities function properly before constructing site improvement (e.g. impervious surfaces). If permanent infiltration ponds are used for flow control during construction, protect these facilities from siltation during the construction phase. %03&&RQVWUXFWLRQDFFHVVDOUHDG\H[LVWVDWFXUUHQWGULYHZD\ORFDWLRQQH[WWRDQGSDUDOOHOWRDOOH\ %03&3DUNLQJZLOOEHXWLOL]HGDWFRQVWUXFWLRQDFFHVVDUHD %03&:KHHOZDVKWREHXWLOL]HGDVQHHGHG Version Date: August 30, 2022 Additional Guidance for Element 3 x Conduct a downstream analysis if changes in flows could impair or alter conveyance systems, streambanks, bed sediment, or aquatic habitat. See III-3.2 Preparing a Stormwater Site Plan for off-site analysis guidelines. x Even gently sloped areas need flow controls such as BMP C235: Wattles or other energy dissipation / filtration structures. Place dissipation facilities closer together on steeper slopes. These methods prevent water from building higher velocities as it flows downstream within the construction site. x Control structures designed for permanent detention BMPs are not appropriate for use during construction without modification. If used during construction, modify the control structure to allow for long-term storage of runoff and enable sediment to settle. Verify that the BMP is sized appropriately for this purpose. Restore BMPs to their original design dimensions, remove sediment, and install a final control structure at completion of the project. x Erosion has the potential to occur because of increases in the volume, velocity, and peak flow rate of stormwater runoff from the project site. The local permitting agency may require infiltration or detention BMP designs that provide additional or different stormwater flow control than the designs detailed in this manual. These requirements may be necessary to address local conditions or to protect properties and waterways downstream. x Velocity of water leaving the site should not exceed 3 feet/second, if the discharge is to a stream or ditch. Install velocity dissipation, such as BMP C207: Check Dams or BMP C202: Riprap Channel Lining to ensure reduction of the flow velocity to a non-erosive level. x If the discharge from a project site is to a municipal storm drainage system, the allowable discharge rate may be limited by the capacity of the public system. It may be necessary to clean the municipal storm drainage system prior to the start of the discharge to prevent scouring solids from the drainage system. Obtain permission from the owner of the collection system before discharging to it. Ensure that no downstream pipes are surcharged as a result of increased flows from the project site. x If the discharge from a project site is directly to a flow control exempt receiving water listed in Appendix I-A: Flow Control Exempt Receiving Waters or to an infiltration system, there is no discharge flow limit. Suggested BMPs for Element 3 x BMP C203: Water Bars x BMP C207: Check Dams x BMP C209: Outlet Protection x BMP C235: Wattles x BMP C240: Sediment Trap x BMP C241: Sediment Pond (Temporary) x See also V-12 Detention BMPs How did you comply with this section? ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ 7KHEXLOGLQJVLWHLVSUHWW\IODWHURVLRQVKRXOGQRWEHDQLVVXH %03&6LOWIHQFHWREHXWLOL]HG %03&YHJHWDWHGVWULSDYHJHWDWHGVWULSZLOOEHUHWDLQHGDURXQGPRVWRIWKHEXLOGLQJLQFOXGLQJDW GRZQVORSHVLGH Version Date: August 30, 2022 ELEMENT 4: Install Sediment Controls Design, install, and maintain effective erosion controls and sediment controls to minimize the discharge of pollutants. Construct sediment control BMPs (sediment ponds, traps, filters, etc.) as one of the first steps in grading. These BMPs shall be functional before other land disturbing activities take place. Minimize sediment discharges from the site. The design, installation and maintenance of erosion and sediment controls must address factors such as the amount, frequency, intensity and duration of precipitation, the nature of resulting stormwater runoff, and soil characteristics, including the range of soil particle sizes expected to be present on the site. Direct stormwater runoff from disturbed areas through a sediment pond or other appropriate sediment removal BMP, before the runoff leaves a construction site or before discharge to an infiltration facility. Runoff from fully stabilized areas may be discharged without a sediment removal BMP, but must meet the flow control performance standard in Element #3, bullet #1. Locate BMPs intended to trap sediment on-site in a manner to avoid interference with the movement of juvenile salmonids attempting to enter off-channel areas or drainages. Provide and maintain natural buffers around surface waters, direct stormwater to vegetated areas to increase sediment removal, and maximize stormwater infiltration. Where feasible, design outlet structures that withdraw impounded stormwater from the surface to avoid discharging sediment that is still suspended lower in the water column. Additional Guidance for Element 4 x Outlet structures that withdraw impounded stormwater from the surface to avoid discharging sediment that is still suspended lower in the water column are for the construction period only. If installing a floating pump structure, include a stopper to prevent the pump basket from hitting the bottom of the pond. x If a sediment trapping BMP utilizes a control structure that will also be used in a permanent detention BMP application, the control structure construction must be finalized for the permanent BMP application upon project completion. x Install sediment controls in a manner that protects the sensitive areas and their buffers marked in accordance with Element 1: Preserve Vegetation / Mark Clearing Limits. x Where feasible, direct stormwater to vegetated areas to increase sediment removal and maximize stormwater infiltration. x Seed and mulch earthen structures such as dams, dikes, and diversions according to the timing indicated in Element 5: Stabilize Soils. x Full stabilization includes concrete or asphalt paving; quarry spalls used as ditch lining; or the use of rolled erosion products, a bonded fiber matrix product, or vegetative cover in a manner that will fully prevent soil erosion. x The Local Permitting Authority may inspect and approve areas fully stabilized by means other than pavement or quarry spalls. Version Date: August 30, 2022 Suggested BMPs for Element 4: x BMP C231: Brush Barrier x BMP C232: Gravel Filter Berm x BMP C233: Silt Fence x BMP C234: Vegetated Strip x BMP C235: Wattles x BMP C240: Sediment Trap x BMP C241: Sediment Pond (Temporary) x BMP C250: Construction Stormwater Chemical Treatment x BMP C251: Construction Stormwater Filtration How did you comply with this section? ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ELEMENT 5: Stabilize Soils Stabilize exposed and unworked soils by application of effective BMPs that prevent erosion. Applicable BMPs include, but are not limited to: temporary and permanent seeding, sodding, mulching, plastic covering, erosion control fabrics and matting, soil application of polyacrylamide (PAM), the early application of gravel base early on areas to be paved, and dust control. Control stormwater volume and velocity within the site to minimize soil erosion. Control stormwater discharges, including both peak flow rates and total stormwater volume, to minimize erosion at outlets and to minimize downstream channel and stream bank erosion. Soils must not remain exposed and unworked for more than the time periods set forth below to prevent erosion. o During the dry season (May 1 – Sept 30): 7 days o During the wet season (Oct 1 – Apr 30): 2 days Stabilize soils at the end of the shift before a holiday or weekend if needed based on the weather forecast. Stabilize soil stockpiles from erosion, protect with sediment trapping measures, and where possible, be located away from storm drain inlets, waterways, and drainage channels. Minimize the amount of soil exposed during construction activity. Minimize the disturbance of steep slopes. Minimize soil compaction and, unless infeasible, preserve topsoil. %03&SODVWLFFRYHULQJRYHUVRLOVWRFNSLOH %03&VLOWIHQFH %03&YHJHWDWHGVWULSV Version Date: August 30, 2022 Additional Guidance for Element 5 x Soil stabilization BMPs should be appropriate for the time of year, site conditions, estimated duration of use, and potential water quality impacts that stabilization agents may have on downstream waters or ground water. x Ensure that gravel base used for stabilization is clean and does not contain fines or sediment. Suggested BMPs for Element 5: x BMP C120: Temporary and Permanent Seeding x BMP C121: Mulching x BMP C122: Nets and Blankets x BMP C123: Plastic Covering x BMP C124: Sodding x BMP C125: Topsoiling / Composting x BMP C126: Polyacrylamide (PAM) for Soil Erosion Protection x BMP C130: Surface Roughening x BMP C131: Gradient Terraces x BMP C140: Dust Control How did you comply with this section? ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ELEMENT 6: Protect Slopes Design and construct cut-and-fill slopes in a manner to minimize erosion. Applicable practices include, but are not limited to, reducing continuous length of slope with terracing and diversions, reducing slope steepness, and roughening slope surfaces (Ex: track walking). Divert off-site stormwater (run-on) or ground water away from slopes and disturbed areas with interceptor dikes, pipes, and/or swales. Off-site stormwater should be managed separately from stormwater generated on the site. At the top of slopes, collect drainage in pipe slope drains or protected channels to prevent erosion. Temporary pipe slope drains must be sized to convey the flow rate calculated by the one fo the following methods: x Single Event Hydrograph Method: The peak volumetric flow rate calculated using a 10-minute time step from a Type 1A, 10-year, 24-hour frequency storm, or; x Continuous Simulation Method: The 10-year peak flow rate, as determined by an approved continuous runoff model with a 15-minute time step. The hydrologic analysis must use the existing land cover condition for predicting flow rates from tributary areas outside the project limits. For tributary areas on the project site, the analysis must use the temporary or permanent project land cover condition, whichever will produce the highest flow rates. 03&9HJHWDWHGVWULSVWREHUHWDLQHGDURXQGEXLOGLQJVLWH %03&6RLOVWRFNSLOHZLOOEHFRYHUHGZLWKYLVTXHHQ %03&6FKHGXOLQJZKHQURRILVFRPSOHWHGJXWWHUVGRZQVSRXWVZLOOEHLQVWDOOHGDVVRRQDVSRVVLEOHDQG VWRUPZDWHUZLOOEHGLUHFWHGDSSURSULDWHO\ 1RWH7KHPDMRUFRQVWUXFWLRQWRWDNHSODFHGXULQJWKH'U\VHDVRQ$XJ6HSW Version Date: August 30, 2022 If using the Western Washington Hydrology Model (WWHM) to predict flows, bare soil areas should be modeled as "landscaped" area. Place excavated material on the uphill side of trenches, consistent with safety and space considerations. Place check dams at regular intervals within constructed channels that are cut down a slope. Additional Guidance for Element 6 x Consider soil type and its potential for erosion. x Stabilize soils on slopes, as specified in Element 5: Stabilize Soils. x BMP combinations are the most effective method of protecting slopes with disturbed soils. For example, use both BMP C121: Mulching and BMP C122: Nets and Blankets in combination. Suggested BMPs for Element 6: x BMP C120: Temporary and Permanent Seeding x BMP C121: Mulching x BMP C122: Nets and Blankets x BMP C123: Plastic Covering x BMP C124: Sodding x BMP C130: Surface Roughening x BMP C131: Gradient Terraces x BMP C200: Interceptor Dike and Swale x BMP C201: Grass-Lined Channels x BMP C203: Water Bars x BMP C204: Pipe Slope Drains x BMP C205: Subsurface Drains x BMP C206: Level Spreader x BMP C207: Check Dams x BMP C208: Triangular Silt Dike (TSD) How did you comply with this section? ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ %03&3ODVWLFFRYHULQJ 1RWH7KHUHLVYHU\OLWWOHVORSHWRWKHVLWH Version Date: August 30, 2022 ELEMENT 7: Protect Drain Inlets Protect all storm drain inlets made operable during construction so that stormwater runoff does not enter the conveyance system without first being filtered or treated to remove sediment. Clean or remove and replace inlet protection devices when sediment has filled one-third of the available storage (unless a different standard is specified by the product manufacturer). Additional Guidance for Element 7 x Protect all existing storm drain inlets so that stormwater runoff does not enter the conveyance system without first being filtered or treated to remove sediment. x Keep all approach roads clean. Do not allow sediment and street wash water to enter storm drains without prior and adequate treatment (as defined above) unless treatment is provided before the storm drain discharges to waters of the State. x Inlets should be inspected weekly at a minimum and daily during storm events. Suggested BMPs for Element 7 x BMP C220: Inlet Protection How did you comply with this section? ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ELEMENT 8: Stabilize Channels and Outlets Design, construct, and stabilize all on-site conveyance channels to prevent erosion from the flow rate calcultated by one the following methods: o Single Event Hydrograph Method: The peak volumetric flow rate calculated using a 10-minute time step from a Type 1A, 10-year, 24-hour frequency storm, or; o Continuous Simulation Method: The 10-year peak flow rate, as determined by an approved continuous runoff model with a 15-minute time step. The hydrologic analysis must use the existing land cover condition for predicting flow rates from tributary areas outside the project limits. For tributary areas on the project site, the analysis must use the temporary or permanent project land cover condition, whichever will produce the highest flow rates. If using the Western Washington Hydrology Model (WWHM) to predict flows, bare soil areas should be modeled as "landscaped" area. Provide stabilization, including armoring material, adequate to prevent erosion of outlets, adjacent streambanks, slopes, and downstream reaches at the outlets of all conveyance systems. Additional Guidance for Element 8 The best method for stabilizing channels is to completely line the channel with BMP C122: Nets and Blankets first, then add BMP C207: Check Dams as necessary to function as an anchor and to slow the flow of water. %03&,QOHWSURWHFWLRQ:6'27VWDQGDUGSODQ)%03&VWRUPGUDLQLQOHWSURWHFWLRQ Version Date: August 30, 2022 Suggested BMPs for Element 8 x BMP C122: Nets and Blankets x BMP C202: Riprap Channel Lining x BMP C207: Check Dams x BMP C209: Outlet Protection How did you comply with this section? ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ELEMENT 9: Control Pollutants Design, install, implement and maintain effective pollution prevention measures to minimize the discharge of pollutants. The project proponent must: Handle and dispose of all pollutants, including waste materials and demolition debris that occur on site in a manner that does not cause contamination of stormwater. Provide cover, containment, and protection from vandalism for all chemicals, liquid products, petroleum products, and other materials that have the potential to pose a threat to human health or the environment. On-site fueling tanks must include secondary containment. Secondary containment means placing tanks or containers within an impervious structure capable of containing 110% of the volume contained in the largest tank within the containment structure. Double-walled tanks do not require additional secondary containment. Conduct maintenance, fueling, and repair of heavy equipment and vehicles using spill prevention and control measures. Clean contaminated surfaces immediately following any spill incident. Discharge wheel wash or tire bath wastewater to a separate on-site treatment system that prevents discharge to surface water, or to the sanitary sewer, with local sewer district approval. Apply fertilizers and pesticides in a manner and at application rates that will not result in loss of chemical to stormwater runoff. Follow manufacturers’ label requirements for application rates and procedures. Use BMPs to prevent contamination of stormwater runoff by pH-modifying sources. The sources for this contamination include, but are not limited to: recycled concrete stockpiles, bulk cement, cement kiln dust, fly ash, new concrete washing and curing waters, waste streams generated from concrete grinding and sawing, exposed aggregate processes, dewatering concrete vaults, concrete pumping and mixer washout waters. Adjust the pH of stormwater if necessary to prevent violations of water quality standards. Assure that washout of concrete trucks is performed off site or in designated concrete washout areas only. Do not wash out concrete truck drums or concrete handling equipment onto the ground, or into storm drains, open ditches, streets, or streams. Washout of small concrete handling equipment may be 1RFKDQQHOVRURXWOHWVRQWKLVSURMHFW Version Date: August 30, 2022 disposed of in a formed area awaiting concrete where it will not contaminate surface or ground water. Do not dump excess concrete on site, except in designated concrete washout areas. Concrete spillage or concrete discharge directly to ground water or surface waters of the State is prohibited. Do not wash out to formed areas awaiting infiltration BMPs. Obtain written approval from Ecology before using chemical treatment other than CO2, dry ice, or food grade vinegar to adjust pH. Uncontaminated water from water-only based shaft drilling for construction of building, road, and bridge foundations may be infiltrated provided the wastewater is managed in a way that prohibits discharge to surface waters. Prior to infiltration, water from water-only based shaft drilling that comes into contact with curing concrete must be neutralized until pH is in the range of 6.5 to 8.5 (su). Additional Guidance for Element 9 x Wheel wash and/or tire bath wastewater can be combined with wastewater from concrete washout areas if the wastewaters will be properly disposed of at an offsite location or treatment facility. x Do not use upland land applications for discharging wastewater from concrete washout areas. x Woody debris may be chopped and spread on site. x Conduct oil changes, hydraulic system drain down, solvent and degreasing cleaning operations, fuel tank drain down and removal, and other activities which may result in discharge or spillage of pollutants to the ground or into stormwater runoff using spill prevention measures, such as drip pans. x Clean contaminated surfaces immediately following any discharge or spill incident. Emergency repairs may be performed on-site using temporary plastic placed beneath and, if raining, over the vehicle. Suggested BMPs for Element 9 x BMP C151: Concrete Handling x BMP C152: Sawcutting and Surfacing Pollution Prevention x BMP C153: Material Delivery, Storage, and Containment x BMP C154: Concrete Washout Area x BMP C250: Construction Stormwater Chemical Treatment x BMP C251: Construction Stormwater Filtration x BMP C252: Treating and Disposing of High pH Water x Also see the Source Control BMPs detailed in Volume IV How did you comply with this section? ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ %03&'HVLJQDWHGFRQFUHWHZDVKRXWDUHD &RQWUDFWRULVUHTXLUHGWRKDYHDVSLOOSUHYHQWLRQNLW Version Date: August 30, 2022 ELEMENT 10: Control De-Watering Discharge foundation, vault, and trench dewatering water, which have characteristics similar to stormwater runoff at the site, into a controlled conveyance system before discharge to BMP C240: Sediment Trap or BMP C241: Sediment Pond (Temporary). Discharge foundation, vault, and trench dewatering water, which have similar characteristics to stormwater runoff at the site, into a controlled conveyance system before discharge to Discharge clean, non-turbid dewatering water, such as well-point ground water, to systems tributary to, or directly into surface waters of the State, as specified in Element 8: Stabilize Channels and Outlets, provided the dewatering flow does not cause erosion or flooding of receiving waters. Do not route clean dewatering water through stormwater sediment BMPs. Note that “surface waters of the State” may exist on a construction site as well as off site; for example, a creek running through a site.Handle highly turbid or contaminated dewatering water separately from stormwater. Handle highly turbid or otherwise contaminated dewatering separately from stormwater. Other dewatering treatment or disposal options may include: 1. Infiltration 2. Transport off-site in a vehicle, such as a vacuum flush truck, for legal disposal in a manner that does not pollute state waters. 3. Ecology-approved on-site chemical treatment or other suitable treatment technologies. 4. Sanitary or combined sewer discharge with local sewer district approval, if there is no other option. 5. Use of a sedimentation bag with outfall to a ditch or swale for small volumes of localized dewatering. Additional Guidance for Element 10 x Channels must be stabilized, as specified in Element 8: Stabilize Channels and Outlets. x Construction equipment operation, clamshell digging, concrete tremie pour, or work inside a cofferdam can create highly turbid or contaminated dewatering water. x Discharging sediment-laden (muddy) water into waters of the State likely constitutes violation of water quality standards for turbidity. The easiest way to avoid discharging muddy water is through infiltration and preserving vegetation. x Dewatering water from contaminated sites must be handled separately from stormwater. Direct contaminated stormwater to a sanitary sewer where allowed by the local sewer authority, or to other approved treatment. Suggested BMPs for Element 10 x BMP C203: Water Bars x BMP C236: Vegetative Filtration How did you comply with this section? ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ,IGHZDWHULQJLVGHHPHGQHFHVVDU\GHZDWHULQJEDJVZLOOEHXVHGWRKHOSUHPRYHVHGLPHQWIURPWKH SXPSHGZDWHU Version Date: August 30, 2022 ELEMENT 11: Maintain BMPs Maintain and repair all temporary and permanent erosion and sediment control BMPs as needed to assure continued performance of their intended function in accordance with BMP specifications. Remove all temporary erosion and sediment control BMPs within 30 days after achieving final site stabilization or after the temporary BMPs are no longer needed. Additional Guidance for Element 11 x Some temporary erosion and sediment control BMPs are biodegradable and designed to remain in place following construction. BMP C122: Nets and Blankets is an example of a BMP with biodegradable options. x Provide protection to all BMPs installed for the permanent control of stormwater from sediment and compaction. All BMPs that are to remain in place following completion of construction shall be examined and placed in full operating conditions. If sediment enters the BMPs during construction, it shall be removed and the facility shall be returned to the conditions specified in the construction documents. x Remove or stabilize trapped sediment on site. Permanently stabilize disturbed soil resulting from removal of BMPs or vegetation. Suggested BMPs for Element 11 x BMP C150: Materials on Hand x BMP C160: Certified Erosion and Sediment Control Lead How did you comply with this section? ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ELEMENT 12: Manage the Project Phase development projects to the maximum degree practicable and take into account seasonal work limitations. Inspect, maintain and repair all BMPs as needed to assure continued performance of their intended function. Projects regulated under the Construction Stormwater General Permit (CSWGP) must conduct site inspections and monitoring in accordance with Special Condition S4 of the CSWGP. Maintain, update, and implement the Construction SWPPP. Projects that disturb one or more acres must have site inspections conducted by a Certified Erosion and Sediment Control Lead (CESCL). Project sites disturbing less than one acre may have a CESCL or a person without CESCL certification conduct inspections. By the initiation of construction, the Construction SWPPP must identify the CESCL or inspector, who must be present on site or on-call at all times. %03&0DWHULDOVRQKDQG3ODVWLFDQGVLOWIHQFHPDWHULDOV 7HPSRUDU\%03 VZLOOEHUHPRYHGDIWHUFRQVWUXFWLRQDQGPDLQWDLQHGGXULQJFRQVWUXFWLRQ Version Date: August 30, 2022 Additional Guidance for Element 12 The project manager must ensure that the project is built in such a way to comply with all Construction SWPPP Elements, as detailed in this section. Considerations for the project manager include, but are not limited to: x construction phasing x seasonal work limitations x coordination with utilities and other contractors x inspection x monitoring x maintaining an updated construction SWPPP Phasing of Construction Phase development projects where feasible in order to prevent soil erosion and transporting of sediment from the site during construction. Revegetate exposed areas and maintain that vegetation as an integral part of the clearing activities for any phase. Clearing and grading activities for developments shall be permitted only if conducted using an approved site development plan (e.g., subdivision approval) that establishes permitted areas of clearing, grading, cutting, and filling. Minimize removing trees and disturbing or compacting native soils when establishing permitted clearing and grading areas. Show on the site plans and the development site permitted clearing and grading areas and any other areas required to preserve critical or sensitive areas, buffers, native growth protection easements, or tree retention areas as may be required by local jurisdictions. Inspection All BMPs must be inspected, maintained, and repaired as needed to assure continued performance of their intended function. Site inspections must be conducted by a person knowledgeable in the principles and practices of erosion and sediment control. The person must have the skills to 1) assess the site conditions and construction activities that could impact the quality of stormwater, and 2) assess the effectiveness of erosion and sediment control measures used to control the quality of stormwater discharges. For construction sites one acre or larger that discharge stormwater to surface waters of the state, a CESCL must be identified in the construction SWPPP; this person must be on-site or on-call at all times. Certification must be obtained through an approved training program that meets the erosion and sediment control training standards established by Ecology. See BMP C160: Certified Erosion and Sediment Control Lead. Appropriate BMPs or design changes shall be implemented as soon as possible whenever inspection and/or monitoring reveals that the BMPs identified in the Construction SWPPP are inadequate, due to the actual discharge of /or potential to discharge a significant amount of any pollutant. The CESCL or inspector must examine stormwater visually for the presence of suspended sediment, turbidity, discoloration, and oil sheen. They must evaluate the effectiveness of BMPs and determine if it is necessary to install, maintain, or repair BMPs to improve the quality of stormwater discharges. Based on the results of the inspection, construction site operators must correct the problems identified by: x Reviewing the Construction SWPPP for compliance with the 13 elements and making appropriate revisions within 7 days of the inspection. x Immediately beginning the process of fully implementing and maintaining appropriate source control and/or treatment BMPs as soon as possible, addressing the problems no later than within 10 days of the inspection. If installation of necessary treatment BMPs is not feasible within 10 days, the construction site operator may request an extension within the initial 10-day response period. x Documenting BMP implementation and maintenance in the site log book (applies only to sites that have coverage under the Construction Stormwater General Permit). Version Date: August 30, 2022 The CESCL or inspector must inspect all areas disturbed by construction activities, all BMPs, and all stormwater discharge points at least once every calendar week and within 24 hours of any discharge from the site. (For purposes of this condition, individual discharge events that last more than one day do not require daily inspections. For example, if a stormwater pond discharges continuously over the course of a week, only one inspection is required that week.) The CESCL or inspector may reduce the inspection frequency for temporary stabilized, inactive sites to once every calendar month Maintaining an Updated Construction SWPPP Retain the Construction SWPPP on-site or within reasonable access to the site. Modify the Construction SWPPP whenever there is a change in the design, construction, operation, or maintenance at the construction site that has, or could have, a significant effect on the discharge of pollutants to waters of the state. The Construction SWPPP must be modified if, during inspections or investigations conducted by the owner/operator, or the applicable local or state regulatory authority, it is determined that the Construction SWPPP is ineffective in eliminating or significantly minimizing pollutants in stormwater discharges from the site. Modify the Construction SWPPP as necessary to include additional or modified BMPs designed to correct problems identified. Complete revisions to the Construction SWPPP within seven (7) days following the inspection. Suggested BMPs for Element 12 x BMP C150: Materials on Hand x BMP C160: Certified Erosion and Sediment Control Lead x BMP C162: Scheduling How did you comply with this section? ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ELEMENT 13: Protect Low Impact Development BMPS The primary purpose of On-Site Stormwater Management is to reduce the disruption of the natural site hydrology through infiltration. BMPs used to meet I-3.4.5 MR5: On-Site Stormwater Management (often called LID BMPs) are permanent facilities. Protect all LID BMPs (including, but not limited to BMP T7.30: Bioretention, BMP T5.14: Rain Gardens, and BMP T5.15: Permeable Pavements) from sedimentation through installation and maintenance of erosion and sediment control BMPs on portions of the site that drain into the LID BMPs. Restore the BMPs to their fully functioning condition if they accumulate sediment during construction. Restoring the BMP must include removal of sediment and any sediment-laden Bioretention/Rain Garden soils, and replacing the removed soils with soils meeting the design specification. Maintain the infiltration capabilities of LID BMPs by protecting against compaction by construction equipment and foot traffic. Protect completed lawn and landscaped areas from compaction due to construction equipment. Control erosion and avoid introducing sediment from surrounding land uses onto BMP T5.15: Permeable Pavements. Do not allow muddy construction equipment on the base material or pavement. Do not allow sediment-laden runoff onto permeable pavements or base materials. %03&0DWHULDOVRQKDQG3ODVWLFDQGVLOWIHQFHPDWHULDOV %03&6FKHGXOLQJ&RQVWUXFWLRQZLOOEHOLPLWHGGXULQJUDLQ\SHULRGV1RWHPDMRU FRQVWUXFWLRQLVWRWDNHSODFHGXULQJWKH'U\VHDVRQ Version Date: August 30, 2022 Permeable pavement fouled with sediments or no longer passing an initial infiltration test must be cleaned using procedures in accordance with this manual or the manufacturer’s procedures. Keep all heavy equipment off existing soils under LID BMPs that have been excavated to final grade to retain the infiltration rate of the soils. Additional Guidance for Element 13 See Chapter 5: Precision Site Preparation, Construction & Inspection of LID Facilities in the LID Technical Guidance Manual for Puget Sound (Hinman and Wulkan, 2012) for more detail on protecting LID integrated management practices. Note that the LID Technical Guidance Manual for Puget Sound (Hinman and Wulkan, 2012) is for additional informational purposes only. You must follow the guidance within this manual if there are any discrepancies between this manual and the LID Technical Guidance Manual for Puget Sound (Hinman and Wulkan, 2012). Suggested BMPs for Element 13 x BMP C102: Buffer Zones x BMP C103: High-Visibility Fence x BMP C200: Interceptor Dike and Swale x BMP C201: Grass-Lined Channels x BMP C207: Check Dams x BMP C208: Triangular Silt Dike (TSD) x BMP C231: Brush Barrier x BMP C233: Silt Fence x BMP C234: Vegetated Strip How did you comply with this section? ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________________________________ ________________________________________________________________ Applicant Signature Date %03&+LJKYLVLELOLW\IHQFH %03&6LOWIHQFH %03&9HJHWDWHGVWULS Jim Dunlap 7/17/23 Version Date: August 30, 2022 TAB 3 (MINIMUM REQUIREMENT #3) x 1-3.4.3 Minimum Requirement #3 – Source Control of Pollution All known, available and reasonable source control BMP’s must be applied to all projects. Source control BMP’s must be selected, designed, maintained according to the reference Ecology Manual. The intent of source control BMP’s is to prevent stormwater from coming in contact with pollutants. They are a cost-effective means of reducing pollutants in stormwater and should be considered in all projects. Supplemental Guidelines Source Control BMPs include Operational BMPs and Structural Source Control BMPs. See Volume IV for design details of these BMPs. For construction sites, see II-3.2 Construction Source Control BMPs. Structural Source Control BMPs should be identified in the stormwater site plan and should be shown on all applicable plans submitted for local government review and approval. An adopted and implemented Basin Plan (see Appendix I-B: Basin Plans) or Total Maximum Daily Load (see I-2.13 Total Maximum Daily Loads (TMDLs)) may be used to develop more stringent source control requirements that are tailored to a specific basin. Identifying Source Control Strategies in a Basin Plan Basin Plans can identify potential sources of pollution within the basin and develop strategies to eliminate or control these sources to protect beneficial uses. A Basin Plan can include the following Source Control strategies: 1. Detection and correction of illicit discharges to storm sewer systems, including the use of dry weather sampling and dye-tracing techniques; 2. Identification of existing businesses, industries, utilities, and other activities that may store materials susceptible to spillage or leakage of pollutants into the storm sewer system or to the ground via wells, drains, or sumps; 3. Elimination or control of pollutant sources identified in (2); 4. Identification and control of future businesses, industries, utilities, and other activities which may store materials susceptible to spillage or leakage of pollutants into the storm sewer system; and 5. Training and public education A Basin Plan that incorporates the standard requirements from this section as well as more stringent requirements does not require Ecology approval. What Source Control BMP’s are applicable to your project? __________________________________________________________________________________ __________________________________________________________________________________ __________________________________________________________________________________ __________________________________________________________________________________ __________________________________________________________________________________ __________________________________________________________________________________ Version Date: August 30, 2022 TAB 4 (MINIMUM REQUIREMENT #4) x 1-3.4.4 Minimum Requirement #4 – Preservation of Natural Drainage Systems and Outfalls Natural drainage patterns shall be maintained and discharges from the project shall occur at the natural location, to maximum extent practicable. The manner by which runoff is discharged from the project site must not cause a significant adverse impact to downstream receiving waters and down gradient properties. All outfalls require energy dissipation. The objective is to preserve and utilize drainage systems to the fullest extent because of the multiple stormwater benefits these systems provide; and to prevent erosion at the downstream of the discharge location. Refer to the referenced section of the manual for supplemental guidelines and additional information under this section. Will this project disturb the Natural Drainage System or Outfall of the project Site? Yes\No. If yes, refer to section I-3.4.4 for Supplemental Guidelines for additional information. Version Date: August 30, 2022 TAB 5 (MINIMUM REQUIREMENT #5) x 1-3.4.5 Minimum Requirement #5 – On-site Stormwater Management Projects shall employ Stormwater Management BMPs in accordance with the following thresholds, standards, and lists to infiltrate, disperse, and retain stormwater runoff on site to the extent feasible without causing flooding or erosion impacts. Project thresholds that trigger Minimum Requirements #1 through #5, shall utilize the On-site Stormwater Management BMP’s from List #1 for all surfaces within each type of surface in List #1; or, Demonstrate compliance with the LID Performance Standard. Projects selecting this option cannot use Rain Gardens. They may choose to use Bioretention BMP’s as described in Chapter V-7 – Infiltration and Bioretention Treatment Facilities to achieve the LID Performance Standard. Refer to this section of the reference Manual for all Feasibility or Infeasibility Criteria for List #1 and List #2. Is this project Flow Control Exempt? ______ (Yes\No) (See Appendix I-E: Flow Control-Exempt Surface Water). If yes, provide reasoning from the applicability section of 1-2.5.7 Minimum Requirement #7: Flow Control). If No, then the project triggers Minimum Requirement #7 (1-2.5.7) and possibly Minimum Requirement #8 (1-2.5.8). __________________________________________________________________________________ __________________________________________________________________________________ __________________________________________________________________________________ __________________________________________________________________________________ __________________________________________________________________________________ If the project is Flow Control Exempt, select from the List 3 below: (Skip List 1 and List 2) o BMP T5.13 Post Construction Soils Quality and Depth o BMP T5.10A: Downspout Full Infiltration, or; o BMP T5.10B Downspout Dispersion Systems, or; o BMP T5.10C: Performated Stub-out Connections, or; LID Performance Standard The LID Performance Standard compliance method for Minimum Requirement #5 requires modeling the proposed Flow Control BMPs to demonstrate the flow reduction as described below. Note that in order to meet the LID Performance Standard, the chosen Flow Control BMPs will most likely need to include infiltration. Stormwater discharges shall match developed discharge durations to pre-developed durations for the range of pre-developed discharge rates from 8% of the 2-year peak flow to 50% of the 2-year peak flow. Refer to the Flow Control Performance Standard section in I-3.4.7 MR7: Flow Control for information about the assignment of the pre-developed condition. Project sites that must also meet I-3.4.7 MR7: Flow Control must match flow durations between 8% of the 2-year flow through the full 50-year flow. Designers selecting this option cannot use BMP T5.14: Rain Gardens to achieve the LID Performance Standard. They may choose to use BMP T7.30: Bioretention to achieve the LID Performance Standard. Version Date: August 30, 2022 The List Approach The List Approach compliance method for Minimum Requirement #5 requires evaluating the BMPs in Table I-3.2: The List Approach for MR5 Compliance. For each surface, evaluate the feasibility of the BMPs in the order listed, and use the first BMP that is considered feasible. The designer must document the site conditions and infeasibility criteria used to deem BMPs infeasible. Once a BMP is deemed feasible and used for a surface, no other BMP from the list is necessary for that surface. If all BMPs in the list are infeasible, then the designer must document the site conditions and infeasibility criteria used to deem each BMP infeasible. This documentation will demonstrate compliance with Minimum Requirement #5. Feasibility shall be determined by evaluation against: x Design criteria, limitations, and infeasibility criteria identified for each BMP in this manual; and x Competing Needs Criteria as listed below. ______________________________________________________________________________________ All sites are required to utilize BMP T5.13 – Post Construction Soil Quality and Depth. For each surface, consider the BMP’s in the order listed for that type of surface. Use the first BMP that is considered feasible. No other on-site Stormwater Management BMP is necessary for that surface. Feasiblity shall be determined by evaluation against: 1. Design criteria, limitations and infeasiblity criteria identified for each BMP in this manual, and; 2.Competing needs criteria listed in Chapter V-5 – On-site Stormwater Management. Lawn and Landscaped Area: x BMP T5.13: Post-Construction Soil Quality and Depth. (Attach Detail in Report) Refer to this site for requirements and specifications. All projects are required to utilize this BMP. http://www.soilsforsalmon.org/pdf/Soil_BMP_Manual.pdf See Appendix 3 for the “Model Soil Management Plan for BMP T5.13” to be submitted with Drainage Report and Application Material. An alternate document acceptable to the City of Anacortes is a Test Report provided by the Soils Supplier that identifies the soils to be used meet the specifications outlined under Minimum Requirement 5. The specifications are in both WSDOT and CSI Formats. For specifications, refer to the above referenced PDF. This submittal can be a deferred submittal since most projects are not sure who the supplier will be at the time of building permit application. For projects that trigger Minimum Requirements 1 through 5, the Test Report will be provided to the Building Department. Projects triggering Minimum Requirements 1 through 9, the Test Report will be provided to the Engineering Department. Version Date: August 30, 2022 List #1 – Project Triggering Minimum Requirement 1 through 5 For each surface, consider the BMPs in the order listed for that type of surface. Use the first BMP that is considered feasible. No ther On-site Stormwater Management BMP is necessary for that surface. Provide feasible detail under each BMP with maintenance and operations specifications in Minimum Requirement 5. Roofs: List #1 1.BMP T5.30: Full Dispersion (Feasible\Infeasible) If infeasible, provide the criteria: _______________________________________________________________________________ _______________________________________________________________________________ _______________________________________________________________________________ _______________________________________________________________________________ Or, T5.10A: Downspout Full Infiltration (Feasible\Infeasible) If infeasible, provide the criteria: _______________________________________________________________________________ _______________________________________________________________________________ _______________________________________________________________________________ _______________________________________________________________________________ 2.BMP T5.14: Rain Gardens (Feasible\Infeasible) If infeasible, provide the criteria: _______________________________________________________________________________ _______________________________________________________________________________ _______________________________________________________________________________ _______________________________________________________________________________ Or, BMP T7.30: Bioretention Cells, Swales, and Planter Boxes (Feasible\Infeasible) If infeasible, provide the criteria: _______________________________________________________________________________ _______________________________________________________________________________ _______________________________________________________________________________ _______________________________________________________________________________ 3.BMP T5.10B: Downspout Dispersion Systems (Feasible\Infeasible) If infeasible, provide the criteria: _______________________________________________________________________________ _______________________________________________________________________________ _______________________________________________________________________________ _______________________________________________________________________________ 4.BMP T5.10C: Perforated Stub-out Connections (Feasible\Infeasible) If infeasible, provide the criteria: _______________________________________________________________________________ _______________________________________________________________________________ _______________________________________________________________________________ _______________________________________________________________________________ Version Date: August 30, 2022 Other Hard Surfaces: List #1 1. BMP T.5.30 Full Dispersion (Feasible\Infeasible) If infeasible, provide the criteria: _______________________________________________________________________________ _______________________________________________________________________________ _______________________________________________________________________________ _______________________________________________________________________________ 2.BMP T5.15: Permeable Pavements (Feasible\Infeasible) If infeasible, provide the criteria: _______________________________________________________________________________ _______________________________________________________________________________ _______________________________________________________________________________ _______________________________________________________________________________ Or, BMP T.14: Rain Gardens (Feasible\Infeasible) If infeasible, provide the criteria: _______________________________________________________________________________ _______________________________________________________________________________ _______________________________________________________________________________ _______________________________________________________________________________ Or, BMP T7.30: Biorention Cells, Swales and Planter Boxes (Feasible\Infeasible) If infeasible, provide the criteria: _______________________________________________________________________________ _______________________________________________________________________________ _______________________________________________________________________________ _______________________________________________________________________________ 3.BMP T5.12: Sheet Flow Dispersion (Feasible\Infeasible) If infeasible, provide the criteria: _______________________________________________________________________________ _______________________________________________________________________________ _______________________________________________________________________________ _______________________________________________________________________________ Or, BMP T5.11: Concentrated Flow Dispersion (Feasible\Infeasible) If infeasible, provide the criteria: _______________________________________________________________________________ _______________________________________________________________________________ _______________________________________________________________________________ _______________________________________________________________________________ ___________________________________________ _____________________ Applicant Signature Date Version Date: August 30, 2022 List #2 – Project Triggering Minimum Requirement 1 through 9 For each surface, consider the BMPs in the order listed for that type of surface. Use the first BMP that is considered feasible. No ther On-site Stormwater Management BMP is necessary for that surface. Provide feasible detail under each BMP with maintenance and operations specifications in Minimum Requirement 5. Roofs: List #2 1.BMP T5.30: Full Dispersion (Feasible\Infeasible) If infeasible, provide the criteria: _______________________________________________________________________________ _______________________________________________________________________________ _______________________________________________________________________________ _______________________________________________________________________________ Or, T5.10A: Downspout Full Infiltration (Feasible\Infeasible) If infeasible, provide the criteria: ________________________________________________________________________ ________________________________________________________________________ ________________________________________________________________________ ________________________________________________________________________ 2.BMP T7.30: Biorention (Feasible\Infeasible) If infeasible, provide the criteria: ________________________________________________________________________ ________________________________________________________________________ ________________________________________________________________________ ________________________________________________________________________ 3.BMP T5.10B: Downspout Dispersion Systems (Feasible\Infeasible) If infeasible, provide the criteria: _______________________________________________________________________________ _______________________________________________________________________________ _______________________________________________________________________________ _______________________________________________________________________________ 2.BMP T5.10C: Perforated Stub-out Connections (Feasible\Infeasible) If infeasible, provide the criteria: ________________________________________________________________________ ________________________________________________________________________ ________________________________________________________________________ ________________________________________________________________________ Version Date: August 30, 2022 Other Hard Surfaces: List #2 1.BMP T.5.30 Full Dispersion (Feasible\Infeasible) If infeasible, provide the criteria: _______________________________________________________________________________ _______________________________________________________________________________ _______________________________________________________________________________ _______________________________________________________________________________ 2.BMP T5.15: Permeable Pavements (Feasible\Infeasible) If infeasible, provide the criteria: _______________________________________________________________________________ _______________________________________________________________________________ _______________________________________________________________________________ _______________________________________________________________________________ 3.BMP T7.30: Biorention (Feasible\Infeasible) If infeasible, provide the criteria: _______________________________________________________________________________ _______________________________________________________________________________ _______________________________________________________________________________ _______________________________________________________________________________ 4.BMP T5.12: Sheet Flow Dispersion (Feasible\Infeasible) If infeasible, provide the criteria: _______________________________________________________________________________ _______________________________________________________________________________ _______________________________________________________________________________ _______________________________________________________________________________ Or, BMP T5.11: Concentrated Flow Dispersion (Feasible\Infeasible) If infeasible, provide the criteria: ________________________________________________________________________ ________________________________________________________________________ ________________________________________________________________________ ________________________________________________________________________ ___________________________________________ _____________________ Applicant Signature Date Version Date: August 30, 2022 TAB 6 – (MINUMUM REQUIREMENT 6 - RUNOFF TREATMENT) Refer to 1.2.5.6 and provide the required information for this Minimum Requirement. Version Date: August 30, 2022 TAB 7 – (MINUMUM REQUIREMENT 7 – FLOW CONTROL) Refer to 1.2.5.7 and provide the required information for this Minimum Requirement. Version Date: August 30, 2022 TAB 8 – (MINUMUM REQUIREMENT 8 – WETLAND PROTECTION) Refer to 1.2.5.8 and provide the required information for this Minimum Requirement. Version Date: August 30, 2022 TAB 9 – (MINUMUM REQUIREMENT 9 – OPERATION AND MAINTENANCE) Refer to 1.2.5.9 and provide the required information for this Minimum Requirement. Version Date: August 30, 2022 APPENDIX 1 – Survey performed by a Professional Land Surveyor The object of this appendix is to ensure that the property has a minimum of 3 out of 5 property corners visible to ensure that the structures are placed within the required setbacks. 1RWHVXUYH\KDVEHHQSHUIRUPHGDQGFRS\RIVXUYH\LQFOXGHGZLWKSHUPLWDSSOLFDWLRQ7KHFRUQHUVRIWKH SURSHUW\KDYHEHHQVWDNHG Version Date: August 30, 2022 APPENDIX 2 – Soils Anaylsis (Volume 3, Chapter 3.3.2) Provide the soils report in this appendix 0DS8QLW'HVFULSWLRQ 7KHPDSXQLWVGHOLQHDWHGRQWKHGHWDLOHGVRLOPDSVLQDVRLOVXUYH\UHSUHVHQWWKH VRLOVRUPLVFHOODQHRXVDUHDVLQWKHVXUYH\DUHD7KHPDSXQLWGHVFULSWLRQVLQWKLV UHSRUWDORQJZLWKWKHPDSVFDQEHXVHGWRGHWHUPLQHWKHFRPSRVLWLRQDQG SURSHUWLHVRIDXQLW $PDSXQLWGHOLQHDWLRQRQDVRLOPDSUHSUHVHQWVDQDUHDGRPLQDWHGE\RQHRU PRUHPDMRUNLQGVRIVRLORUPLVFHOODQHRXVDUHDV$PDSXQLWLVLGHQWLILHGDQG QDPHGDFFRUGLQJWRWKHWD[RQRPLFFODVVLILFDWLRQRIWKHGRPLQDQWVRLOV:LWKLQD WD[RQRPLFFODVVWKHUHDUHSUHFLVHO\GHILQHGOLPLWVIRUWKHSURSHUWLHVRIWKHVRLOV 2QWKHODQGVFDSHKRZHYHUWKHVRLOVDUHQDWXUDOSKHQRPHQDDQGWKH\KDYHWKH FKDUDFWHULVWLFYDULDELOLW\RIDOOQDWXUDOSKHQRPHQD7KXVWKHUDQJHRIVRPH REVHUYHGSURSHUWLHVPD\H[WHQGEH\RQGWKHOLPLWVGHILQHGIRUDWD[RQRPLFFODVV $UHDVRIVRLOVRIDVLQJOHWD[RQRPLFFODVVUDUHO\LIHYHUFDQEHPDSSHGZLWKRXW LQFOXGLQJDUHDVRIRWKHUWD[RQRPLFFODVVHV&RQVHTXHQWO\HYHU\PDSXQLWLV PDGHXSRIWKHVRLOVRUPLVFHOODQHRXVDUHDVIRUZKLFKLWLVQDPHGVRLOVWKDWDUH VLPLODUWRWKHQDPHGFRPSRQHQWVDQGVRPHPLQRUFRPSRQHQWVWKDWGLIIHULQXVH DQGPDQDJHPHQWIURPWKHPDMRUVRLOV 0RVWRIWKHVRLOVVLPLODUWRWKHPDMRUFRPSRQHQWVKDYHSURSHUWLHVVLPLODUWRWKRVH RIWKHGRPLQDQWVRLORUVRLOVLQWKHPDSXQLWDQGWKXVWKH\GRQRWDIIHFWXVHDQG PDQDJHPHQW7KHVHDUHFDOOHGQRQFRQWUDVWLQJRUVLPLODUFRPSRQHQWV7KH\ PD\RUPD\QRWEHPHQWLRQHGLQDSDUWLFXODUPDSXQLWGHVFULSWLRQ6RPHPLQRU FRPSRQHQWVKRZHYHUKDYHSURSHUWLHVDQGEHKDYLRUFKDUDFWHULVWLFVGLYHUJHQW HQRXJKWRDIIHFWXVHRUWRUHTXLUHGLIIHUHQWPDQDJHPHQW7KHVHDUHFDOOHG FRQWUDVWLQJRUGLVVLPLODUFRPSRQHQWV7KH\JHQHUDOO\DUHLQVPDOODUHDVDQG FRXOGQRWEHPDSSHGVHSDUDWHO\EHFDXVHRIWKHVFDOHXVHG6RPHVPDOODUHDVRI VWURQJO\FRQWUDVWLQJVRLOVRUPLVFHOODQHRXVDUHDVDUHLGHQWLILHGE\DVSHFLDO V\PERORQWKHPDSV,ILQFOXGHGLQWKHGDWDEDVHIRUDJLYHQDUHDWKHFRQWUDVWLQJ PLQRUFRPSRQHQWVDUHLGHQWLILHGLQWKHPDSXQLWGHVFULSWLRQVDORQJZLWKVRPH FKDUDFWHULVWLFVRIHDFK$IHZDUHDVRIPLQRUFRPSRQHQWVPD\QRWKDYHEHHQ REVHUYHGDQGFRQVHTXHQWO\WKH\DUHQRWPHQWLRQHGLQWKHGHVFULSWLRQV HVSHFLDOO\ZKHUHWKHSDWWHUQZDVVRFRPSOH[WKDWLWZDVLPSUDFWLFDOWRPDNH HQRXJKREVHUYDWLRQVWRLGHQWLI\DOOWKHVRLOVDQGPLVFHOODQHRXVDUHDVRQWKH ODQGVFDSH 7KHSUHVHQFHRIPLQRUFRPSRQHQWVLQDPDSXQLWLQQRZD\GLPLQLVKHVWKH XVHIXOQHVVRUDFFXUDF\RIWKHGDWD7KHREMHFWLYHRIPDSSLQJLVQRWWRGHOLQHDWH SXUHWD[RQRPLFFODVVHVEXWUDWKHUWRVHSDUDWHWKHODQGVFDSHLQWRODQGIRUPVRU ODQGIRUPVHJPHQWVWKDWKDYHVLPLODUXVHDQGPDQDJHPHQWUHTXLUHPHQWV7KH GHOLQHDWLRQRIVXFKVHJPHQWVRQWKHPDSSURYLGHVVXIILFLHQWLQIRUPDWLRQIRUWKH GHYHORSPHQWRIUHVRXUFHSODQV,ILQWHQVLYHXVHRIVPDOODUHDVLVSODQQHG KRZHYHURQVLWHLQYHVWLJDWLRQLVQHHGHGWRGHILQHDQGORFDWHWKHVRLOVDQG PLVFHOODQHRXVDUHDV $QLGHQWLI\LQJV\PEROSUHFHGHVWKHPDSXQLWQDPHLQWKHPDSXQLWGHVFULSWLRQV (DFKGHVFULSWLRQLQFOXGHVJHQHUDOIDFWVDERXWWKHXQLWDQGJLYHVLPSRUWDQWVRLO SURSHUWLHVDQGTXDOLWLHV 0DS8QLW'HVFULSWLRQ&ODOODP8UEDQODQGFRPSOH[WRSHUFHQWVORSHV6NDJLW&RXQW\ $UHD:DVKLQJWRQ WK6W 1DWXUDO5HVRXUFHV &RQVHUYDWLRQ6HUYLFH :HE6RLO6XUYH\ 1DWLRQDO&RRSHUDWLYH6RLO6XUYH\ 3DJHRI 6RLO0DS²6NDJLW&RXQW\$UHD:DVKLQJWRQ WK6W 1DWXUDO5HVRXUFHV &RQVHUYDWLRQ6HUYLFH :HE6RLO6XUYH\ 1DWLRQDO&RRSHUDWLYH6RLO6XUYH\ 3DJHRI 1 : 1 : 1 : 1 : 1 0DSSURMHFWLRQ:HE0HUFDWRU&RUQHUFRRUGLQDWHV:*6(GJHWLFV870=RQH1:*6 )HHW 0HWHUV 0DS6FDOHLISULQWHGRQ$SRUWUDLW[VKHHW 6RLOO0DSSPD\\QRWWEHHYDOLGGDWWWKLVVVFDOH 0$ 3 / ( * ( 1 ' 0$ 3 , 1 ) 2 5 0 $ 7 , 2 1 $U H D R I , Q W H U H V W $ 2 , $U H D R I , Q W H U H V W $ 2 , 6R L O V 6R L O 0 D S 8 Q L W 3 R O \ J R Q V 6R L O 0 D S 8 Q L W / L Q H V 6R L O 0 D S 8 Q L W 3 R L Q W V 6S H F L D O 3 R L Q W ) H D W X U H V %OR Z R X W %R U U R Z 3 L W &O D \ 6 S R W &O R V H G ' H S U H V V L R Q *U D Y H O 3 L W *U D Y H O O \ 6 S R W /D Q G I L O O /D Y D ) O R Z 0D U V K R U V Z D P S 0LQ H R U 4 X D U U \ 0LV F H O O D Q H R X V : D W H U 3H U H Q Q L D O : D W H U 5R F N 2 X W F U R S 6D O L Q H 6 S R W 6D Q G \ 6 S R W 6H Y H U H O \ ( U R G H G 6 S R W 6LQ N K R O H 6OL G H R U 6 O L S 6R G L F 6 S R W 6S R L O $ U H D 6W R Q \ 6 S R W 9H U \ 6 W R Q \ 6 S R W :H W 6 S R W 2W K H U 6S H F L D O / L Q H ) H D W X U H V :D W H U ) H D W X U H V 6W U H D P V D Q G & D Q D O V 7U D Q V S R U W D W L R Q 5D L O V ,Q W H U V W D W H + L J K Z D \ V 86 5 R X W H V 0D M R U 5 R D G V /R F D O 5 R D G V %D F N J U R X Q G $H U L D O 3 K R W R J U D S K \ 7K H V R L O V X U Y H \ V W K D W F R P S U L V H \ R X U $ 2 , Z H U H P D S S H G D W :D U Q L Q J 6 R L O 0 D S P D \ Q R W E H Y D O L G D W W K L V V F D O H (Q O D U J H P H Q W R I P D S V E H \ R Q G W K H V F D O H R I P D S S L Q J F D Q F D X V H PL V X Q G H U V W D Q G L Q J R I W K H G H W D L O R I P D S S L Q J D Q G D F F X U D F \ R I V R L O OL Q H S O D F H P H Q W 7 K H P D S V G R Q R W V K R Z W K H V P D O O D U H D V R I FR Q W U D V W L Q J V R L O V W K D W F R X O G K D Y H E H H Q V K R Z Q D W D P R U H G H W D L O H G VF D O H 3OH D V H U H O \ R Q W K H E D U V F D O H R Q H D F K P D S V K H H W I R U P D S PH D V X U H P H Q W V 6R X U F H R I 0 D S 1 D W X U D O 5 H V R X U F H V & R Q V H U Y D W L R Q 6 H U Y L F H :H E 6 R L O 6 X U Y H \ 8 5 / &R R U G L Q D W H 6 \ V W H P : H E 0 H U F D W R U ( 3 6 * 0D S V I U R P W K H : H E 6 R L O 6 X U Y H \ D U H E D V H G R Q W K H : H E 0 H U F D W R U SU R M H F W L R Q Z K L F K S U H V H U Y H V G L U H F W L R Q D Q G V K D S H E X W G L V W R U W V GL V W D Q F H D Q G D U H D $ S U R M H F W L R Q W K D W S U H V H U Y H V D U H D V X F K D V W K H $OE H U V H T X D O D U H D F R Q L F S U R M H F W L R Q V K R X O G E H X V H G L I P R U H DF F X U D W H F D O F X O D W L R Q V R I G L V W D Q F H R U D U H D D U H U H T X L U H G 7K L V S U R G X F W L V J H Q H U D W H G I U R P W K H 8 6 ' $ 1 5 & 6 F H U W L I L H G G D W D D V RI W K H Y H U V L R Q G D W H V O L V W H G E H O R Z 6R L O 6 X U Y H \ $ U H D 6 N D J L W & R X Q W \ $ U H D : D V K L Q J W R Q 6X U Y H \ $ U H D ' D W D 9 H U V L R Q 6 H S 6R L O P D S X Q L W V D U H O D E H O H G D V V S D F H D O O R Z V I R U P D S V F D O H V R U O D U J H U 'D W H V D H U L D O L P D J H V Z H U H S K R W R J U D S K H G - X O ² - X O 7K H R U W K R S K R W R R U R W K H U E D V H P D S R Q Z K L F K W K H V R L O O L Q H V Z H U H FR P S L O H G D Q G G L J L W L ] H G S U R E D E O \ G L I I H U V I U R P W K H E D F N J U R X Q G LP D J H U \ G L V S O D \ H G R Q W K H V H P D S V $ V D U H V X O W V R P H P L Q R U VK L I W L Q J R I P D S X Q L W E R X Q G D U L H V P D \ E H H Y L G H Q W 6R L O 0 D S ² 6 N D J L W & R X Q W \ $ U H D : D V K L Q J W R Q W K 6 W 1D W X U D O 5 H V R X U F H V &R Q V H U Y D W L R Q 6 H U Y L F H :H E 6 R L O 6 X U Y H \ 1D W L R Q D O & R R S H U D W L Y H 6 R L O 6 X U Y H \ 3D J H R I 0DS8QLW/HJHQG 0DS8QLW6\PERO 0DS8QLW1DPH $FUHVLQ$2,3HUFHQWRI$2, &ODOODP8UEDQODQGFRPSOH[ WRSHUFHQWVORSHV 7RWDOVIRU$UHDRI,QWHUHVW 6RLO0DS²6NDJLW&RXQW\$UHD:DVKLQJWRQ WK6W 1DWXUDO5HVRXUFHV &RQVHUYDWLRQ6HUYLFH :HE6RLO6XUYH\ 1DWLRQDO&RRSHUDWLYH6RLO6XUYH\ 3DJHRI 6RLOVWKDWKDYHSURILOHVWKDWDUHDOPRVWDOLNHPDNHXSDVRLOVHULHV$OOWKHVRLOVRI DVHULHVKDYHPDMRUKRUL]RQVWKDWDUHVLPLODULQFRPSRVLWLRQWKLFNQHVVDQG DUUDQJHPHQW6RLOVRIDJLYHQVHULHVFDQGLIIHULQWH[WXUHRIWKHVXUIDFHOD\HU VORSHVWRQLQHVVVDOLQLW\GHJUHHRIHURVLRQDQGRWKHUFKDUDFWHULVWLFVWKDWDIIHFW WKHLUXVH2QWKHEDVLVRIVXFKGLIIHUHQFHVDVRLOVHULHVLVGLYLGHGLQWRVRLO SKDVHV0RVWRIWKHDUHDVVKRZQRQWKHGHWDLOHGVRLOPDSVDUHSKDVHVRIVRLO VHULHV7KHQDPHRIDVRLOSKDVHFRPPRQO\LQGLFDWHVDIHDWXUHWKDWDIIHFWVXVHRU PDQDJHPHQW)RUH[DPSOH$OSKDVLOWORDPWRSHUFHQWVORSHVLVDSKDVHRI WKH$OSKDVHULHV 6RPHPDSXQLWVDUHPDGHXSRIWZRRUPRUHPDMRUVRLOVRUPLVFHOODQHRXVDUHDV 7KHVHPDSXQLWVDUHFRPSOH[HVDVVRFLDWLRQVRUXQGLIIHUHQWLDWHGJURXSV $FRPSOH[FRQVLVWVRIWZRRUPRUHVRLOVRUPLVFHOODQHRXVDUHDVLQVXFKDQ LQWULFDWHSDWWHUQRULQVXFKVPDOODUHDVWKDWWKH\FDQQRWEHVKRZQVHSDUDWHO\RQ WKHPDSV7KHSDWWHUQDQGSURSRUWLRQRIWKHVRLOVRUPLVFHOODQHRXVDUHDVDUH VRPHZKDWVLPLODULQDOODUHDV$OSKD%HWDFRPSOH[WRSHUFHQWVORSHVLVDQ H[DPSOH $QDVVRFLDWLRQLVPDGHXSRIWZRRUPRUHJHRJUDSKLFDOO\DVVRFLDWHGVRLOVRU PLVFHOODQHRXVDUHDVWKDWDUHVKRZQDVRQHXQLWRQWKHPDSV%HFDXVHRI SUHVHQWRUDQWLFLSDWHGXVHVRIWKHPDSXQLWVLQWKHVXUYH\DUHDLWZDVQRW FRQVLGHUHGSUDFWLFDORUQHFHVVDU\WRPDSWKHVRLOVRUPLVFHOODQHRXVDUHDV VHSDUDWHO\7KHSDWWHUQDQGUHODWLYHSURSRUWLRQRIWKHVRLOVRUPLVFHOODQHRXV DUHDVDUHVRPHZKDWVLPLODU$OSKD%HWDDVVRFLDWLRQWRSHUFHQWVORSHVLVDQ H[DPSOH $QXQGLIIHUHQWLDWHGJURXSLVPDGHXSRIWZRRUPRUHVRLOVRUPLVFHOODQHRXVDUHDV WKDWFRXOGEHPDSSHGLQGLYLGXDOO\EXWDUHPDSSHGDVRQHXQLWEHFDXVHVLPLODU LQWHUSUHWDWLRQVFDQEHPDGHIRUXVHDQGPDQDJHPHQW7KHSDWWHUQDQG SURSRUWLRQRIWKHVRLOVRUPLVFHOODQHRXVDUHDVLQDPDSSHGDUHDDUHQRWXQLIRUP $QDUHDFDQEHPDGHXSRIRQO\RQHRIWKHPDMRUVRLOVRUPLVFHOODQHRXVDUHDVRU LWFDQEHPDGHXSRIDOORIWKHP$OSKDDQG%HWDVRLOVWRSHUFHQWVORSHVLV DQH[DPSOH 6RPHVXUYH\VLQFOXGHPLVFHOODQHRXVDUHDV6XFKDUHDVKDYHOLWWOHRUQRVRLO PDWHULDODQGVXSSRUWOLWWOHRUQRYHJHWDWLRQ5RFNRXWFURSLVDQH[DPSOH $GGLWLRQDOLQIRUPDWLRQDERXWWKHPDSXQLWVGHVFULEHGLQWKLVUHSRUWLVDYDLODEOHLQ RWKHUVRLOUHSRUWVZKLFKJLYHSURSHUWLHVRIWKHVRLOVDQGWKHOLPLWDWLRQV FDSDELOLWLHVDQGSRWHQWLDOVIRUPDQ\XVHV$OVRWKHQDUUDWLYHVWKDWDFFRPSDQ\ WKHVRLOUHSRUWVGHILQHVRPHRIWKHSURSHUWLHVLQFOXGHGLQWKHPDSXQLW GHVFULSWLRQV 6NDJLW&RXQW\$UHD:DVKLQJWRQ ²&ODOODP8UEDQODQGFRPSOH[WRSHUFHQWVORSHV 0DS8QLW6HWWLQJ 1DWLRQDOPDSXQLWV\PEROKYI (OHYDWLRQWRIHHW 0HDQDQQXDOSUHFLSLWDWLRQLQFKHV 0HDQDQQXDODLUWHPSHUDWXUHGHJUHHV) )URVWIUHHSHULRGWRGD\V 0DS8QLW'HVFULSWLRQ&ODOODP8UEDQODQGFRPSOH[WRSHUFHQWVORSHV6NDJLW&RXQW\ $UHD:DVKLQJWRQ WK6W 1DWXUDO5HVRXUFHV &RQVHUYDWLRQ6HUYLFH :HE6RLO6XUYH\ 1DWLRQDO&RRSHUDWLYH6RLO6XUYH\ 3DJHRI )DUPODQGFODVVLILFDWLRQ1RWSULPHIDUPODQG 0DS8QLW&RPSRVLWLRQ &ODOODPDQGVLPLODUVRLOVSHUFHQW 8UEDQODQGSHUFHQW 0LQRUFRPSRQHQWVSHUFHQW (VWLPDWHVDUHEDVHGRQREVHUYDWLRQVGHVFULSWLRQVDQGWUDQVHFWVRI WKHPDSXQLW 'HVFULSWLRQRI&ODOODP 6HWWLQJ /DQGIRUP+LOOVORSHV 3DUHQWPDWHULDO*ODFLDOGULIW 7\SLFDOSURILOH +WRLQFKHVJUDYHOO\DVK\ORDP +WRLQFKHVYHU\JUDYHOO\ORDP +WRLQFKHVYHU\JUDYHOO\VDQG\ORDP 3URSHUWLHVDQGTXDOLWLHV 6ORSHWRSHUFHQW 'HSWKWRUHVWULFWLYHIHDWXUHWRLQFKHVWRGHQVLFPDWHULDO 'UDLQDJHFODVV0RGHUDWHO\ZHOOGUDLQHG &DSDFLW\RIWKHPRVWOLPLWLQJOD\HUWRWUDQVPLWZDWHU.VDW9HU\ORZ WRPRGHUDWHO\ORZWRLQKU 'HSWKWRZDWHUWDEOH$ERXWWRLQFKHV )UHTXHQF\RIIORRGLQJ1RQH )UHTXHQF\RISRQGLQJ1RQH $YDLODEOHZDWHUVXSSO\WRLQFKHV9HU\ORZDERXWLQFKHV ,QWHUSUHWLYHJURXSV /DQGFDSDELOLW\FODVVLILFDWLRQLUULJDWHGZ /DQGFDSDELOLW\FODVVLILFDWLRQQRQLUULJDWHGV +\GURORJLF6RLO*URXS& (FRORJLFDOVLWH);$:$3XJHW/RZODQGV'U\)RUHVW )RUDJHVXLWDELOLW\JURXS/LPLWHG'HSWK6RLOV*;1:$ 2WKHUYHJHWDWLYHFODVVLILFDWLRQ/LPLWHG'HSWK6RLOV *;1:$ +\GULFVRLOUDWLQJ1R 'HVFULSWLRQRI8UEDQ/DQG ,QWHUSUHWLYHJURXSV /DQGFDSDELOLW\FODVVLILFDWLRQLUULJDWHG1RQHVSHFLILHG /DQGFDSDELOLW\FODVVLILFDWLRQQRQLUULJDWHG +\GULFVRLOUDWLQJ1R 0LQRU&RPSRQHQWV %RZ 3HUFHQWRIPDSXQLWSHUFHQW /DQGIRUP7HUUDFHV 0DS8QLW'HVFULSWLRQ&ODOODP8UEDQODQGFRPSOH[WRSHUFHQWVORSHV6NDJLW&RXQW\ $UHD:DVKLQJWRQ WK6W 1DWXUDO5HVRXUFHV &RQVHUYDWLRQ6HUYLFH :HE6RLO6XUYH\ 1DWLRQDO&RRSHUDWLYH6RLO6XUYH\ 3DJHRI 2WKHUYHJHWDWLYHFODVVLILFDWLRQ6HDVRQDOO\:HW6RLOV *;1:$ +\GULFVRLOUDWLQJ<HV 'DWD6RXUFH,QIRUPDWLRQ 6RLO6XUYH\$UHD 6NDJLW&RXQW\$UHD:DVKLQJWRQ 6XUYH\$UHD'DWD 9HUVLRQ6HS 0DS8QLW'HVFULSWLRQ&ODOODP8UEDQODQGFRPSOH[WRSHUFHQWVORSHV6NDJLW&RXQW\ $UHD:DVKLQJWRQ WK6W 1DWXUDO5HVRXUFHV &RQVHUYDWLRQ6HUYLFH :HE6RLO6XUYH\ 1DWLRQDO&RRSHUDWLYH6RLO6XUYH\ 3DJHRI Version Date: August 30, 2022 APPENDIX 3 – Model Soil Management Plan for BMP T5.13 An alternate document acceptable to the City of Anacortes is a Test Report provided by the Soils Supplier that identifies the soils to be used meet the specifications outlined under Minimum Requirement 5. The specifications are in both WSDOT and CSI Formats. For specifications, refer to the above referenced PDF. This submittal can be a deferred submittal since most projects are not sure who the supplier will be at the time of building permit application. For projects that trigger Minimum Requirements 1 through 5, the Test Report will be provided to the Building Department. Projects triggering Minimum Requirements 1 through 9, the Test Report will be provided to the Engineering Department. Version Date: August 30, 2022 DEFERRED SUBMITTAL: PROVIDE A TEST REPORT FROM SOILS SUPPLIER TO THE BUILDING DEPT. PROJECT INFORMATION “Model Soil Management Plan for BMP T5.13” age # ____ of ____ pages Complete all information on page 1; only site address and permit number on additional pages. Site Address / Lot No.:______________________________________________________________________________ Permit Type: Permit Number: Permit Holder: Phone: Mailing Address:__________________________________________________________________________________ Contact Person: Phone: Plan Prepared By: ATTACHMENTS REQUIRED (Check off required items that are attached to this plan) ___ Site Plan showing, to scale: ___ Areas of undisturbed native vegetation (no amendment required) ___ New planting beds and turf areas (amendment required) ___ Type of soil improvement proposed for each area ___ Soil test results (required if proposing custom amendment rates) ___ Product test results for proposed amendments AREA # (should match Area # on Site Plan) PLANTING TYPE ___ Turf ___ Undisturbed native vegetation ___ Planting Beds ___ Other: _______________________________ SQUARE FOOTAGE OF THIS AREA: _______ square feet SCARIFICATION ___ Subsoil will be scarified ___ inches (depth) of scarification needed to achieve finished total 12” loosened depth. PRE-APPROVED AMENDMENT METHOD: ___ Topsoil import ___ Amend with compost ___ Stockpile and amend ( ____ cu. yds. stockpiled) ____inches of compost or imported topsoil applied X 3.1 (conversion factor, inches to cubic yards) _____= cu. yards per 1,000 sq. ft. X ___ ,000s sq.ft. in this area ____ = cubic yards of amendment ĺ ĺ ĺ ĺ ĺ (needed to cover this area to designated depth) PRODUCT:_________________________ __________________________________ QUANTITY:________CU. YDS. CUSTOM AMENDMENT ___ Topsoil import ___ Topsoil & compost lift ___ Amend ___ Stockpile and amend (____ cu. yds. stockpiled) Attach test results and calculations. ____ inches organic matter or topsoil import X 3.1 _____= cu. yards / 1,000 sq. ft. X ___ ,000s sq.ft. in this area ____ = cubic yards of amendment ĺ ĺ ĺ ĺ ĺ PRODUCT:_________________________ __________________________________ QUANTITY:________CU. YDS. MULCH ___ ,000 sq.ft. X 6.2 (conversion, to give 2 inch mulch depth) ____ = cubic yards of mulch ĺ ĺ ĺ ĺ ĺ ĺ PRODUCT:_________________________ QUANTITY:________CU. YDS. TOTAL AMENDMENT/TOPSOIL/MULCH FOR ALL AREAS (complete on page 1 only, totaling all areas/pages in this Plan) Product #1:__________________________________________Quantity: _________cu. yds. Test Results: ___ % organic matter ____C:N ratio <25:1 (except mulch, or <35:1 for native plants) ____ “stable” (yes/no) Product #2:__________________________________________Quantity: _________cu. yds. Test Results: ___ % organic matter ____C:N ratio <25:1 (except mulch, or <35:1 for native plants) ____ “stable” (yes/no) Product #3:__________________________________________Quantity: _________cu. yds. Test Results: ___ % organic matter ____C:N ratio <25:1 (except mulch, or <35:1 for native plants) ____ “stable” (yes/no) Date:Inspector:Approved:Revisions Required: Date:Inspector:Approved:Revisions Required: Version Date: August 30, 2022 APPENDIX 4 – Determining Construction Site Sediment Damage Potential (Appendix 7 – NPDES Phase II Permit) Note: See attached. All projects within the City of Anacortes are required to complete that document under Appendix 4. Version Date: August 30, 2022 Western Washington Phase II Stormwater Permit i.APPENDIX 7 – Determining Construction Site Sediment Damage Potential The following rating system allows objective evaluation of a particular development site’s potential to discharge sediment. Permittees may use the rating system below or develop alternative process designed to identify site-specific features which indicate that the site must be inspected prior to clearing and construction. Any alternative evaluation process must be documented and provide for equivalent environmental review. Step one is to determine if there is a sediment/erosion sensitive feature downstream of the development site. If there is such a site downstream complete step two, assessment of hydraulic nearness. If there is a sediment/erosion sensitive feature and it is hydraulically near the site then go to step three to determine the construction site sediment transport potential. ii.STEP 1 – Sediment/Erosion Sensitive Feature Identification Sediment/erosion sensitive features are areas subject to significant degradation due to the effect of sediment deposition or erosion. Special protection must be provided to protect them. Sediment/erosion sensitive features include but are not limited to: i.Salmonid bearing fresh water streams and their tributaries or freshwater streams that would be Salmonid bearing if not for anthropogenic barriers; ii.Lakes; iii.Category I, II, and III wetlands; iv.Marine near-shore habitat; v.Sites containing contaminated soils where erosion could cause dispersal of contaminants; and vi.Steep slopes (25% or greater) associated with one of the above features. Identify any sediment/erosion sensitive features, and proceed to step two. If there are none the assessment is complete. iii.STEP 2 – Hydraulic Nearness Assessment Sites are hydraulically near a feature if the pollutant load and peak quantity of runoff from the site will not be naturally attenuated before entering the feature. The conditions that render a site hydraulically near to a feature include, but are not limited to, the following: i.The feature or a buffer to protect the feature is within 200 feet downstream of the site. ii.Runoff from the site is tight-lined to the feature or flows to the feature through a channel or ditch. August 1, 2013, Modified January 16, 2015 Appendix 7- Determining Sediment Damage Potential Page 1 of 3 A site is not hydraulically near a feature if one of the following takes place to provide attenuation before runoff from the site enters the feature: iv.Sheet flow through a vegetated area with dense ground cover v.Flow through a wetland not included as a sensitive feature vi.Flow through a significant shallow or adverse slope, not in a conveyance channel, between the site and the sensitive feature. Identify any of the sediment/erosion sensitive features from step one that are hydraulically near the site, and proceed to step three. If none of the sediment/erosion sensitive features are hydraulically near the site, the assessment is complete. vii.STEP 3 – Construction Site Sediment Transport Potential Using the worksheet below, determine the total points for each development site. Assign points based on the most critical condition that affects 10% or more of the site. If soil testing has been performed on site, the results should be used to determine the predominant soil type on the site. Otherwise, soil information should be obtained from the county soil survey to determine Hydrologic Soil Group (Table of Engineering Index Properties for step 1.D) and Erosion Potential (Table of Water Features for step 1.E) When using the county soil survey, the dominant soil type may be in question, particularly when the site falls on a boundary between two soil types or when one of two soil types may be present on a site. In this case, the soil type resulting in the most points on the rating system will be assumed unless site soil tests indicate that another soil type dominates the site. Use the point score from Step 3 to determine whether the development site has a high potential for sediment transport off of the site. Total Score Transport Rating <100 Low 100 High A high transport rating indicates a higher risk that the site will generate sediment contaminated runoff. Construction Site Sediment Transport Potential Worksheet A.Existing slope of site (average, weighted by aerial extent):Points 2% or less ... 0 >2-5% .............................................................................................. 5 >5-10% .......................................................................................... 15 >10-15% ........................................................................................ 30 >15% ............................................................................................. 50 B.Site Area to be cleared and/or graded: <5,000 sq. ft ................................................................................... 0 5,000 sq. ft. – 1 acre ..................................................................... 30 >1 acres ....................................................................................... 50 C.Quantity of cut and/or fill on site: <500 cubic yards ............................................................................ 0 500 – 5,000 cubic yards ................................................................... 5 >5,000 – 10,000 cubic yards ......................................................... 10 >10,000 – 20,000 cubic yards ....................................................... 25 >20,000 cubic yards ..................................................................... 40 D.Runoff potential of predominant soils (Natural Resources Conservation Service): Hydrologic soil group A .................................................................................... 0 Hydrologic soil group B ................................................................. 10 Hydrologic soil group C ................................................................. 20 Hydrologic soil group D ................................................................. 40 E.Erosion Potential of predominant soils (Unified Classification System): GW, GP, SW, SP soils .......................................................................................... 0 Dual classifications (GW-GM, GP-GM, GW-GC, GP-GC, SW-SM, SW-SC, SP-SM, SP-SC) .......................... 10 GM, GC, SM, SC soils .................................................................. 20 ML, CL, MH, CH soils ................................................................... 40 F.Surface or Groundwater entering site identified and intercepted1: Yes ................................................................................................. 0 No ................................................................................................ 25 G.Depth of cut or height of fill >10 feet: Yes ............................................................................................... 25 No ........................................................................................................... 0 H.Clearing and grading will occur in the wet season (October 1 – May 1): Yes 50 No ........................................................................................................... 0 TOTAL POINTS............................................................................................. 1 If no surface or groundwater enters site, give 0 points. 5 . 0 . 0 .0 .0 APPENDIX 5 – Site Plan with all applicable information (Minimum Size 11x17 at a legible scale) 6LWH3ODQKDVEHHQLQFOXGHGZLWK$UFKLWHFWXUDOSODQVHW APPENDIX 6 – Documented Site Photos (Show all directions of the site, including frontage) (Insert Photo Here) Location: Description of the photo: Photo taken by: 6HHSKRWRSDJHVLQFOXGHGDWHQGRIGRFXPHQW APPENDIX 7 – Drainage BMP Facility Maintenance Covenant Note: To be recorded prior to: 1) Temporary Certificate of Occupancy; 2) Final Certificate of Occupancy, and or; 3) Final Acceptance of the project. This is Covenant is required for any Permanent Stormwater Facility constructed on a project site. The applicant should work with the the City of Anacortes Engineering Department on formalizing the document for recording. APPENDIX 8 – Maintenance and Operations Manual Property frontage, taken from 4th Street, looking toward the north. (Note: Addition and garage are to go at the back of the property (south side.) Taken from northwest corner of property, looking at south side of existing house where elevator addition will be going. Taken from northwest corner of property, looking toward east at existing garage. This existing garage is to be demo’d completely and replaced with the new larger garage.